Result : EXP00038
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00038 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 6148447 |
| Right | 6148701 |
| Strand | + |
| Nucleotide Sequence | ATGAATGTTGTCATCGCTCTGCTGATCCTGGCCGCACCCGTTGCGGTGGCCGTGACACTGGGCTGGGCGGCCCACCGCGGCAACGTTTTACGGTTCGACCTCGCCCAGTTCCGGGTCGGCGTTCCACTCGCCGGCCGCTTCGACACCCCCGACGCCGACGCATACCGTGCCGCGCACGACGCCGAGGCCATCCGCAGCCGTTTCGAGCAGCACCCGGTGTGGCCGTCAGCCGGCGTTCTCGGCGAGCGCCGCTAG |
| Sequence | MNVVIALLILAAPVAVAVTLGWAAHRGNVLRFDLAQFRVGVPLAGRFDTPDADAYRAAHDAEAIRSRFEQHPVWPSAGVLGERR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6154248 | 6154502 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 2225717 | 2225971 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 3432710 | 3432958 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 4 | 3822396 | 3822650 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 5 | 3947382 | 3947636 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 6 | 5600659 | 5600922 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 7 | 1167445 | 1167696 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 8 | 891707 | 891955 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 9 | 5049558 | 5049821 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 10 | 1555093 | 1555347 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 11 | 3315448 | 3315711 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 12 | 5726628 | 5726879 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 13 | 5469050 | 5469301 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 14 | 2119249 | 2119500 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 15 | 5691071 | 5691328 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 16 | 5551228 | 5551458 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 17 | 601169 | 601411 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 18 | 72995 | 73231 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00484.21 | 1.0 | 18 | 2488.0 | opposite-strand | Carbonic anhydrase |
| 2 | PF00730.27 | 0.78 | 14 | 1568.0 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 3 | PF00633.25 | 1.0 | 18 | 1568.0 | same-strand | Helix-hairpin-helix motif |
| 4 | PF12833.9 | 1.0 | 18 | 72.5 | opposite-strand | Helix-turn-helix domain |
| 5 | PF01965.26 | 0.94 | 17 | 73 | opposite-strand | DJ-1/PfpI family |
| 6 | PF00165.25 | 1.0 | 18 | 72.5 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 7 | PF12697.9 | 1.0 | 18 | -26.0 | opposite-strand | Alpha/beta hydrolase family |
| 8 | PF03992.18 | 1.0 | 18 | 783.0 | same-strand | Antibiotic biosynthesis monooxygenase |
| 9 | PF18042.3 | 1.0 | 18 | 1140.0 | same-strand | ORF 12 gene product N-terminal |
| 10 | PF00300.24 | 0.94 | 17 | 2469 | opposite-strand | Histidine phosphatase superfamily (branch 1) |
| 11 | PF09490.12 | 0.94 | 17 | 3023 | opposite-strand | Probable cobalt transporter subunit (CbtA) |
++ More..