Result : EXP00035
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00035 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 5773222 |
| Right | 5773371 |
| Strand | + |
| Nucleotide Sequence | ATGTCCACGTACTGGGTGTCGTCACTGACATCCATGTTGCGACGCCAGCGCCTGATCATCTTGGTCCGAGCCATGTTGCAGACCTCTCCCTCTCGTCTGAGGTTTACATCTACCCAGGTGTTGTACAACGGTACCGCAGGTATCGAGTAA |
| Sequence | MSTYWVSSLTSMLRRQRLIILVRAMLQTSPSRLRFTSTQVLYNGTAGIE |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5783640 | 5783789 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 4091244 | 4091384 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 3 | 3235244 | 3235384 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00903.27 | 0.67 | 2 | 2682 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 2 | PF18029.3 | 0.67 | 2 | 2682 | same-strand | Glyoxalase-like domain |
| 3 | PF00037.29 | 0.67 | 2 | 969.5 | opposite-strand | 4Fe-4S binding domain |
| 4 | PF12838.9 | 0.67 | 2 | 969.5 | opposite-strand | 4Fe-4S dicluster domain |
| 5 | PF12837.9 | 0.67 | 2 | 969.5 | opposite-strand | 4Fe-4S binding domain |
| 6 | PF13187.8 | 0.67 | 2 | 969.5 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF11583.10 | 1.0 | 3 | -73 | opposite-strand | P-aminobenzoate N-oxygenase AurF |
| 8 | PF00266.21 | 0.67 | 2 | 495.0 | same-strand | Aminotransferase class-V |
| 9 | PF11268.10 | 0.67 | 2 | 1721.5 | same-strand | Protein of unknown function (DUF3071) |
| 10 | PF10801.10 | 0.67 | 2 | 2556.0 | opposite-strand | Protein of unknown function (DUF2537) |
| 11 | PF00588.21 | 0.67 | 2 | 2846.5 | opposite-strand | SpoU rRNA Methylase family |
++ More..