Result : EXP00026

Protein Information

• Protein name: EXP00026
• NCBI Accession ID: CP000480.1
• Organism: Mycolicibacterium smegmatis MC2 155
• Left: 4401804
• Right: 4401896
• Strand: +
• Nucleotide Sequence: ATGTCGTTGGCAAAAGGATTGTCTGATGGTCGATTCGAGCAGTGCTGCTCCCTCATTCCCCACCCTCAACCACGTCGCGGTGACCGTGCGTGA
• Sequence: MSLAKGLSDGRFEQCCSLIPHPQPRRGDRA
• Source of smORF: Ribo-seq
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 30

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4402567	4402659	+	NZ_LN831039.1	Mycolicibacterium smegmatis
2	3956532	3956630	-	NZ_CP012150.1	Mycobacterium goodii
3	966425	966502	-	NZ_CP060244.1	Entomobacter blattae

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LN831039.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01784.20	0.67	2	3402.5	opposite-strand	NIF3 (NGG1p interacting factor 3)
2	PF13419.8	0.67	2	2476.5	same-strand	Haloacid dehalogenase-like hydrolase
3	PF12710.9	0.67	2	2476.5	same-strand	haloacid dehalogenase-like hydrolase
4	PF01451.23	0.67	2	1992.5	same-strand	Low molecular weight phosphotyrosine protein phosphatase
5	PF02104.17	0.67	2	1159.5	same-strand	SURF1 family
6	PF03186.15	0.67	2	222.5	opposite-strand	CobD/Cbib protein
7	PF00903.27	0.67	2	-73.0	same-strand	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
8	PF04542.16	0.67	2	1023.0	same-strand	Sigma-70 region 2
9	PF08281.14	0.67	2	1023.0	same-strand	Sigma-70, region 4
10	PF04545.18	0.67	2	1023.0	same-strand	Sigma-70, region 4
11	PF01035.22	0.67	2	1511.0	same-strand	6-O-methylguanine DNA methyltransferase, DNA binding domain
12	PF02870.17	0.67	2	1511.0	same-strand	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
13	PF09859.11	0.67	2	2071.0	same-strand	Oxygenase, catalysing oxidative methylation of damaged DNA