Result : B0SBL3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000777.1 |
| Organism | Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) |
| Left | 518977 |
| Right | 519252 |
| Strand | + |
| Nucleotide Sequence | TTGGCTAATTTAAAATCATCTAAAAAAGACATCCGTAGAACCGCTCGTAGAAAAGAGCGAAATGGGGAAGACCGTACTGAATTACGCACATACGCACGTCTTCTCATCAAAGCCATCAAATCTGGCGACAAAACGGAAGCATTGACTGTTTTTTCTAAACTATCTTCTAAATTGGACAGAGCTGCGAAAACAAAACTCATCCACAAAAAAAATGCAGATCGTAAAAAATCCCGCATGGCACTTCGCATCAACTCAATTGAGGCAAAAGCCGCCTAA |
| Sequence | MANLKSSKKDIRRTARRKERNGEDRTELRTYARLLIKAIKSGDKTEALTVFSKLSSKLDRAAKTKLIHKKNADRKKSRMALRINSIEAKAA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 18270594 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B0SBL3 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 438215 | 438487 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 422773 | 423045 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 3 | 2801128 | 2801394 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 4 | 702555 | 702827 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 5 | 3554967 | 3555239 | - | NZ_CP040840.1 | Leptospira weilii |
| 6 | 2708918 | 2709187 | + | NZ_CP033614.1 | Leptospira kmetyi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026671.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00535.28 | 1.0 | 6 | 2450.0 | opposite-strand | Glycosyl transferase family 2 |
| 2 | PF02878.18 | 1.0 | 6 | 126.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 3 | PF02879.18 | 1.0 | 6 | 126.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 4 | PF02880.18 | 1.0 | 6 | 126.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 5 | PF01380.24 | 1.0 | 6 | 1511.5 | same-strand | SIS domain |
| 6 | PF13522.8 | 1.0 | 6 | 1511.5 | same-strand | Glutamine amidotransferase domain |
| 7 | PF13537.8 | 1.0 | 6 | 1511.5 | same-strand | Glutamine amidotransferase domain |
| 8 | PF01039.24 | 1.0 | 6 | 4411.5 | same-strand | Carboxyl transferase domain |
++ More..