Result : EXP00015
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00015 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 2274098 |
| Right | 2274328 |
| Strand | + |
| Nucleotide Sequence | ATGTGTTGCCATGGCCTGCACCGGCAATCCCCCTCGAATCCCGGTGCAGGTCATGGTGACCTCGCATACTCGGTACCCACTAGGTGTCCTCGCTGCGTCCGATGCACACCGCGCCACGTGCGGACAACGCCCGTTGTCCAGCTCAGGACGGTCGACTCGGCCCGTGGTGGCGGCGGCGCACACACGCTGAGGGTCGAGGCGCGGCGGTCCATCGGCTCGACTCAGTTTTGA |
| Sequence | MCCHGLHRQSPSNPGAGHGDLAYSVPTRCPRCVRCTPRHVRTTPVVQLRTVDSARGGGGAHTLRVEARRSIGSTQF |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2348431 | 2348661 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 6057188 | 6057418 | - | NZ_CP012150.1 | Mycobacterium goodii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02771.18 | 1.0 | 2 | 3059.0 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 2 | PF00441.26 | 1.0 | 2 | 3059.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 3 | PF02770.21 | 1.0 | 2 | 3059.0 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 4 | PF13426.9 | 1.0 | 2 | 2522.5 | same-strand | PAS domain |
| 5 | PF08448.12 | 1.0 | 2 | 2522.5 | same-strand | PAS fold |
| 6 | PF07739.15 | 1.0 | 2 | 1683.0 | same-strand | TipAS antibiotic-recognition domain |
| 7 | PF13411.8 | 1.0 | 2 | 1683.0 | same-strand | MerR HTH family regulatory protein |
| 8 | PF00376.25 | 1.0 | 2 | 1683.0 | same-strand | MerR family regulatory protein |
| 9 | PF09278.13 | 1.0 | 2 | 1683.0 | same-strand | MerR, DNA binding |
| 10 | PF00440.25 | 1.0 | 2 | 679.5 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 11 | PF00563.22 | 1.0 | 2 | 829.5 | opposite-strand | EAL domain |
| 12 | PF00990.23 | 1.0 | 2 | 829.5 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 13 | PF01590.28 | 1.0 | 2 | 829.5 | opposite-strand | GAF domain |
| 14 | PF13185.8 | 1.0 | 2 | 829.5 | opposite-strand | GAF domain |
| 15 | PF00551.21 | 1.0 | 2 | 5005.5 | same-strand | Formyl transferase |
++ More..