Result : HVO_A0556
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_A0556 |
| NCBI Accession ID | CP001955.1 |
| Organism | Haloferax volcanii DS2 plasmid pHV4 |
| Left | 559749 |
| Right | 559892 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGAATCCGCACACCTGCTCGGTACGTTCGACGAAGAAGACTGCACCTACTGCGACGGCGACCTTGTGACGGGAAGTTACAAAGACAACGACGCCATCGTCTGCGACGACTGCGGCACGCCCGCGGTCCAACTCTGGTAA |
| Sequence | MAESAHLLGTFDEEDCTYCDGDLVTGSYKDNDAIVCDDCGTPAVQLW |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in its ability to grow in glycerol-containing medium and to swarm. It shows a gain of function phenotype in the context of growth in the presence of bile acids and has enhanced ability to form biofilm. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1159013 | 1159156 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 2 | 559749 | 559892 | + | NC_013966.1 | Haloferax volcanii DS2 |
| 3 | 129122 | 129265 | + | NZ_CP011949.1 | Haloferax gibbonsii |
| 4 | 243758 | 243901 | + | NZ_CP039140.1 | Haloferax mediterranei ATCC 33500 |
| 5 | 202602 | 202757 | + | NC_014735.1 | Halogeometricum borinquense DSM 11551 |
| 6 | 1478329 | 1478463 | - | NZ_CP071463.1 | Haloterrigena longa |
| 7 | 40076 | 40204 | + | NZ_CP040638.1 | Natrinema pallidum |
++ More..