Protein name |
HVO_A0556 |
NCBI Accession ID |
CP001955.1 |
Organism |
Haloferax volcanii DS2 plasmid pHV4 |
Left |
559749 |
Right |
559892 |
Strand |
+ |
Nucleotide Sequence |
ATGGCCGAATCCGCACACCTGCTCGGTACGTTCGACGAAGAAGACTGCACCTACTGCGACGGCGACCTTGTGACGGGAAGTTACAAAGACAACGACGCCATCGTCTGCGACGACTGCGGCACGCCCGCGGTCCAACTCTGGTAA |
Sequence |
MAESAHLLGTFDEEDCTYCDGDLVTGSYKDNDAIVCDDCGTPAVQLW |
Source of smORF |
Literature-mining |
Function |
The deletion mutant is inhibited in its ability to grow in glycerol-containing medium and to swarm. It shows a gain of function phenotype in the context of growth in the presence of bile acids and has enhanced ability to form biofilm. |
Pubmed ID |
31083437
|
Domain |
|
Functional Category |
Others |
Uniprot ID |
|
ORF Length (Amino Acid) |
47 |