Result : HVO_A0089
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_A0089 |
| NCBI Accession ID | CP001955.1 |
| Organism | Haloferax volcanii DS2 plasmid pHV4 |
| Left | 91575 |
| Right | 91754 |
| Strand | - |
| Nucleotide Sequence | ATGGCGGAGTTCGAGAATCCATACGCACAGGCAAATCCATTTGTCAGAGCGCACTTTGACTGCTTGAACTGTGGCGGAAAACTGTGGGAGTACGCCATTCAAGACCGGATGGTATGTGAGGACTGCCGCGAATTGTTCGACTCCTCAGAGATATTCGACAAATCAATTGGCCATGAGTAA |
| Sequence | MAEFENPYAQANPFVRAHFDCLNCGGKLWEYAIQDRMVCEDCRELFDSSEIFDKSIGHE |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in its growth in glycerol-containing medium. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 91575 | 91754 | - | NC_013966.1 | Haloferax volcanii DS2 |
| 2 | 450508 | 450690 | - | NZ_CP007056.1 | Halostagnicola larsenii XH-48 |
| 3 | 44857 | 45027 | - | NZ_CP058580.1 | Halobaculum salinum |
| 4 | 66800 | 66976 | - | NZ_CP058530.1 | Halobaculum halophilum |
| 5 | 1321058 | 1321240 | + | NZ_LN831302.1 | Halobacterium hubeiense |
| 6 | 118672 | 118842 | - | NZ_AP017558.1 | Halopenitus persicus |
| 7 | 2660237 | 2660422 | + | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007056.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01557.20 | 0.71 | 5 | 3090 | same-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 2 | PF07883.13 | 1.0 | 7 | 120 | same-strand | Cupin domain |
| 3 | PF13607.8 | 0.86 | 6 | 1489 | same-strand | Succinyl-CoA ligase like flavodoxin domain |
| 4 | PF13380.8 | 0.86 | 6 | 1489 | same-strand | CoA binding domain |
| 5 | PF02629.21 | 0.86 | 6 | 1489 | same-strand | CoA binding domain |
| 6 | PF13549.8 | 0.86 | 6 | 944.5 | both-strands | ATP-grasp domain |
++ More..