Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S6 |
NCBI Accession ID | AP008971.1 |
Organism | Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) (Peptostreptococcus magnus) |
Left | 1240406 |
Right | 1240693 |
Strand | - |
Nucleotide Sequence | ATGAACAAATATGAATTAGTGCTAATCTTTAAGCCAGAATTATCAGAAGAAGACAGAAACACTGTATTCTCAAGAATTCAACAAGTAATTGACGAAAATGGTAAACTTGAAGAAGTTCACGATTGGGGAAAAAGAAAATTAGCTTATGAAATTAACTACATCAAAGAAGGATACTATTATATTGTAAACTTCGATTTAGATCCACAATTTGTTAAGGAAATCGAAAGAAGATGTAGATTATTCGACCAAATCATTAGATACATGGTTGTTAGAGTTGACGAACAATAA |
Sequence | MNKYELVLIFKPELSEEDRNTVFSRIQQVIDENGKLEEVHDWGKRKLAYEINYIKEGYYYIVNFDLDPQFVKEIERRCRLFDQIIRYMVVRVDEQ |
Source of smORF | Swiss-Prot |
Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
Pubmed ID | 18263572 |
Domain | CDD:412366 |
Functional Category | Ribosomal_protein |
Uniprot ID | B0S2G9 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 138345 | 138629 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
2 | 1546659 | 1546943 | - | NZ_LT632322.1 | Murdochiella vaginalis |
3 | 1416624 | 1416908 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
4 | 88582 | 88866 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
5 | 136031 | 136315 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
6 | 733241 | 733525 | + | NZ_CP009761.1 | Parvimonas micra |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01084.22 | 1.0 | 6 | 543.0 | same-strand | Ribosomal protein S18 |
2 | PF00436.27 | 1.0 | 6 | 7.5 | same-strand | Single-strand binding protein family |