Result : B0S2G9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AP008971.1 |
| Organism | Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) (Peptostreptococcus magnus) |
| Left | 1240406 |
| Right | 1240693 |
| Strand | - |
| Nucleotide Sequence | ATGAACAAATATGAATTAGTGCTAATCTTTAAGCCAGAATTATCAGAAGAAGACAGAAACACTGTATTCTCAAGAATTCAACAAGTAATTGACGAAAATGGTAAACTTGAAGAAGTTCACGATTGGGGAAAAAGAAAATTAGCTTATGAAATTAACTACATCAAAGAAGGATACTATTATATTGTAAACTTCGATTTAGATCCACAATTTGTTAAGGAAATCGAAAGAAGATGTAGATTATTCGACCAAATCATTAGATACATGGTTGTTAGAGTTGACGAACAATAA |
| Sequence | MNKYELVLIFKPELSEEDRNTVFSRIQQVIDENGKLEEVHDWGKRKLAYEINYIKEGYYYIVNFDLDPQFVKEIERRCRLFDQIIRYMVVRVDEQ |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 18263572 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B0S2G9 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 138345 | 138629 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 2 | 1546659 | 1546943 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 3 | 1416624 | 1416908 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 4 | 88582 | 88866 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 5 | 136031 | 136315 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 6 | 733241 | 733525 | + | NZ_CP009761.1 | Parvimonas micra |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP067016.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01084.22 | 1.0 | 6 | 543.0 | same-strand | Ribosomal protein S18 |
| 2 | PF00436.27 | 1.0 | 6 | 7.5 | same-strand | Single-strand binding protein family |
++ More..