Result : HVO_2901
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_2901 |
| NCBI Accession ID | CP001956.1 |
| Organism | Haloferax volcanii DS2 |
| Left | 2738566 |
| Right | 2738730 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGGACTGCAACAGCAGCGGGCCCGCGGGCGAGACATGTTGGAGTGTCGAGGTTGTGGGGCCGTATTCCCGGAGGGACGAGCGACGAACGACGGGTGGACGTACGTCTGTCCCGAGTGTGAACAGGTCGAAGGTATCGGCGAGGGGCTTCGTCGCCTCTGA |
| Sequence | MAGLQQQRARGRDMLECRGCGAVFPEGRATNDGWTYVCPECEQVEGIGEGLRRL |
| Source of smORF | Literature-mining |
| Function | The deletion mutant has better ability to grow in the presence of bile acids and shows an enhanced ability to form biofilm. It is inhibited in its swarming abilities. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2825284 | 2825448 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 2 | 2738566 | 2738730 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 3 | 3678420 | 3678584 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 4 | 2411713 | 2411877 | - | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 5 | 1340898 | 1341062 | + | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 6 | 2277813 | 2277977 | + | NZ_CP026309.1 | Salinigranum rubrum |
| 7 | 1716778 | 1716942 | - | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 8 | 3057629 | 3057778 | + | NZ_CP031150.1 | Haloplanus rubicundus |
| 9 | 792849 | 792998 | - | NZ_CP034345.1 | Haloplanus rallus |
| 10 | 2680664 | 2680813 | + | NZ_CP034145.1 | Haloplanus aerogenes |
| 11 | 2606059 | 2606226 | + | NZ_CP058579.1 | Halobaculum salinum |
| 12 | 770258 | 770425 | - | NZ_CP058529.1 | Halobaculum halophilum |
| 13 | 448956 | 449123 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 14 | 429024 | 429191 | + | NZ_CP082286.1 | Halobaculum roseum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011947.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00206.22 | 1.0 | 14 | 236.0 | same-strand | Lyase |
| 2 | PF10415.11 | 1.0 | 14 | 236.0 | same-strand | Fumarase C C-terminus |
| 3 | PF02934.17 | 0.79 | 11 | 139 | same-strand | GatB/GatE catalytic domain |
| 4 | PF02637.20 | 0.79 | 11 | 139 | same-strand | GatB domain |
| 5 | PF02938.16 | 0.79 | 11 | 139 | same-strand | GAD domain |
++ More..