ProsmORF-pred
Result : HVO_2400
Protein Information
Information Type Description
Protein name HVO_2400
NCBI Accession ID CP001956.1
Organism Haloferax volcanii DS2
Left 2268759
Right 2268935
Strand +
Nucleotide Sequence ATGAGCGACCTCGAAATCGAACGCGAGTGCCCGGCCTGCGGCAACGACACGTTCTACCTCGCCGCCAGCATGGAGATTCACCTCGGCACGAAGACGAAGTGGCACTGCACGGAGTGCGACTACGGTTACATCCACATCACGGACGACATCGAGACGTACGCGAAGGCCGAAGCGTAA
Sequence MSDLEIERECPACGNDTFYLAASMEIHLGTKTKWHCTECDYGYIHITDDIETYAKAEA
Source of smORF Literature-mining
Function The deletion mutant has better ability to grow in glycerol-containing medium as compared to wild-type.
Pubmed ID 31083437
Domain
Functional Category Others
Uniprot ID
ORF Length (Amino Acid) 58
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 24
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2364384 2364560 + NZ_CP011947.1 Haloferax gibbonsii
2 2268759 2268935 + NC_013967.1 Haloferax volcanii DS2
3 3084299 3084475 + NZ_CP048738.1 Haloferax alexandrinus
4 2877774 2877950 - NZ_CP039139.1 Haloferax mediterranei ATCC 33500
5 93691 93858 - NC_015666.1 Halopiger xanaduensis SH-6
6 3626229 3626387 - NZ_CP058335.1 Natronomonas salina
7 778000 778152 + NC_014729.1 Halogeometricum borinquense DSM 11551
8 3670181 3670360 + NZ_CP058579.1 Halobaculum salinum
9 4288084 4288257 - NZ_CP058910.1 Halosimplex rubrum
10 1748465 1748635 + NZ_LN831302.1 Halobacterium hubeiense
11 2735102 2735266 + NC_019974.1 Natronococcus occultus SP4
12 383337 383510 + NC_013922.1 Natrialba magadii ATCC 43099
13 701783 701947 + NZ_CP058334.1 Natronomonas halophila
14 1361553 1361729 - NZ_CP024047.1 Natrarchaeobaculum sulfurireducens
15 2800504 2800683 - NC_019792.1 Natronobacterium gregoryi SP2
16 1705234 1705398 + NC_019964.1 Halovivax ruber XH-70
17 603905 604075 - NZ_CP073366.1 Haloarcula sinaiiensis ATCC 33800
18 1329800 1329970 + NC_006396.1 Haloarcula marismortui ATCC 43049
19 1983447 1983617 + NZ_CP019154.1 Haloarcula taiwanensis
20 1810994 1811158 - NC_013202.1 Halomicrobium mukohataei DSM 12286
21 2112830 2113009 + NC_008212.1 Haloquadratum walsbyi DSM 16790
22 2845236 2845391 + NZ_CP026309.1 Salinigranum rubrum
23 2179448 2179594 + NZ_CP034940.1 Halorubrum ezzemoulense
24 1635655 1635822 + NZ_CP011564.1 Halanaeroarchaeum sulfurireducens
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP011947.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02347.18 0.71 17 2020 opposite-strand Glycine cleavage system P-protein
++ More..