Result : HVO_2142
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_2142 |
| NCBI Accession ID | CP001956.1 |
| Organism | Haloferax volcanii DS2 |
| Left | 2005419 |
| Right | 2005571 |
| Strand | - |
| Nucleotide Sequence | ATGAGTTCAGACCACACGAATACCACCCACTCCGAATGGTGTCCCGACTGCGGCTCCGAGATGGCCTTCACCGGCACGCAGCCGGCGGGGCTCGCGCAGTTCTTCTGCGAGCAGTGTCGGTACCGCCGCGACCGCTTCGTCGGCGGCGACTGA |
| Sequence | MSSDHTNTTHSEWCPDCGSEMAFTGTQPAGLAQFFCEQCRYRRDRFVGGD |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in its ability to grow in glycerol-containing medium and to swarm. It shows a gain of function phenotype in the context of growth in the presence of bile acids and has enhanced ability to form biofilm. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2005419 | 2005571 | - | NC_013967.1 | Haloferax volcanii DS2 |
| 2 | 2872709 | 2872861 | - | NZ_CP048738.1 | Haloferax alexandrinus |
| 3 | 1942797 | 1942949 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 4 | 179341 | 179502 | + | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 5 | 3862319 | 3862483 | + | NZ_CP026309.1 | Salinigranum rubrum |
| 6 | 622773 | 622922 | - | NZ_CP026309.1 | Salinigranum rubrum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013967.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07732.17 | 0.6 | 3 | 170 | same-strand | Multicopper oxidase |
| 2 | PF00127.22 | 0.6 | 3 | 980.0 | both-strands | Copper binding proteins, plastocyanin/azurin family |
| 3 | PF10006.11 | 0.6 | 3 | 141 | same-strand | Uncharacterized conserved protein (DUF2249) |
| 4 | PF04055.23 | 0.6 | 3 | 533 | opposite-strand | Radical SAM superfamily |
| 5 | PF13473.8 | 0.6 | 3 | 1796 | opposite-strand | Cupredoxin-like domain |
++ More..