Result : HVO_1118
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_1118 |
| NCBI Accession ID | CP001956.1 |
| Organism | Haloferax volcanii DS2 |
| Left | 1020539 |
| Right | 1020673 |
| Strand | + |
| Nucleotide Sequence | ATGCGCGAGTTCGACGTGACCTGTCCCGAGTGCGGCGAGCGCTACCGGGTCAACGAGCCGATGATGCGGACGCTCCGGGAGACCGGCTGCGTCCTCTGTACCGCGCCGCTGAACGACGCCGCGAAGTCAGCGTGA |
| Sequence | MREFDVTCPECGERYRVNEPMMRTLRETGCVLCTAPLNDAAKSA |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in the presence of bile acids. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1806407 | 1806541 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 2 | 1020539 | 1020673 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 3 | 1030953 | 1031087 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 4 | 1707726 | 1707860 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048738.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00091.27 | 1.0 | 4 | 2280.5 | same-strand | Tubulin/FtsZ family, GTPase domain |
| 2 | PF08745.13 | 1.0 | 4 | 1495.5 | same-strand | PINc domain ribonuclease |
| 3 | PF12840.9 | 1.0 | 4 | 921 | opposite-strand | Helix-turn-helix domain |
| 4 | PF09339.12 | 0.75 | 3 | 921.0 | opposite-strand | IclR helix-turn-helix domain |
| 5 | PF12802.9 | 1.0 | 4 | 920.5 | opposite-strand | MarR family |
| 6 | PF04967.14 | 1.0 | 4 | 95.0 | same-strand | HTH DNA binding domain |
| 7 | PF00127.22 | 1.0 | 4 | 34.0 | opposite-strand | Copper binding proteins, plastocyanin/azurin family |
| 8 | PF10518.11 | 0.75 | 3 | 34 | opposite-strand | TAT (twin-arginine translocation) pathway signal sequence |
| 9 | PF04055.23 | 1.0 | 4 | 982.0 | same-strand | Radical SAM superfamily |
| 10 | PF13186.8 | 1.0 | 4 | 982.0 | same-strand | Iron-sulfur cluster-binding domain |
| 11 | PF07992.16 | 0.75 | 3 | 2522 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 12 | PF00070.29 | 0.75 | 3 | 2522 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
++ More..