Result : HVO_0758
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_0758 |
| NCBI Accession ID | CP001956.1 |
| Organism | Haloferax volcanii DS2 |
| Left | 680745 |
| Right | 680915 |
| Strand | - |
| Nucleotide Sequence | ATGAAGACAACGCGGAAGGGGCTTCGAGACGGGGAGTTGGAAAAAGACACCTACGGACGGCTGACCTGCTCCGAGTGCGGCGAGTCGCTGAAGAAGAAAAACGACCCCGACGAGGTGTTCTCGGTCCGTATCTGCGCCGACTGCGGGCGCGAGTGGAAGGAACTCAGATAA |
| Sequence | MKTTRKGLRDGELEKDTYGRLTCSECGESLKKKNDPDEVFSVRICADCGREWKELR |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in glycerol-containing medium. It has enhanced ability to form biofilms and is inhibited in swarming abilities. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 680745 | 680915 | - | NC_013967.1 | Haloferax volcanii DS2 |
| 2 | 728977 | 729147 | - | NZ_CP048738.1 | Haloferax alexandrinus |
| 3 | 673666 | 673836 | - | NZ_CP011947.1 | Haloferax gibbonsii |
| 4 | 1311028 | 1311198 | - | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 5 | 2353933 | 2354103 | + | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 6 | 378925 | 379095 | - | NZ_CP058529.1 | Halobaculum halophilum |
| 7 | 1750428 | 1750598 | + | NZ_CP031150.1 | Haloplanus rubicundus |
| 8 | 958798 | 958968 | - | NZ_CP026309.1 | Salinigranum rubrum |
| 9 | 1244756 | 1244926 | - | NZ_CP034345.1 | Haloplanus rallus |
| 10 | 1195909 | 1196079 | + | NZ_CP034145.1 | Haloplanus aerogenes |
| 11 | 2126873 | 2127043 | - | NZ_AP017558.1 | Halopenitus persicus |
| 12 | 21668 | 21838 | - | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 13 | 21599 | 21769 | - | NZ_CP082286.1 | Halobaculum roseum |
| 14 | 1461949 | 1462119 | - | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 15 | 1687514 | 1687684 | - | NZ_CP034940.1 | Halorubrum ezzemoulense |
| 16 | 1105693 | 1105863 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 17 | 2941925 | 2942095 | - | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 18 | 3218049 | 3218219 | - | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 19 | 76724 | 76894 | - | NZ_CP031306.1 | Natronorubrum bangense |
| 20 | 280992 | 281162 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 21 | 2499693 | 2499863 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 22 | 2701258 | 2701428 | - | NC_013922.1 | Natrialba magadii ATCC 43099 |
| 23 | 100125 | 100295 | + | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 24 | 2992605 | 2992775 | - | NZ_CP040637.1 | Natrinema pallidum |
| 25 | 2183967 | 2184137 | - | NZ_CP071463.1 | Haloterrigena longa |
| 26 | 3397357 | 3397527 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 27 | 957971 | 958141 | + | NZ_CP065856.1 | Halosimplex litoreum |
| 28 | 1567753 | 1567923 | - | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 29 | 1340148 | 1340318 | - | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 30 | 2297196 | 2297366 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 31 | 1927741 | 1927911 | - | NZ_CP058910.1 | Halosimplex rubrum |
| 32 | 3013975 | 3014145 | + | NZ_CP058579.1 | Halobaculum salinum |
| 33 | 584930 | 585100 | - | NC_019792.1 | Natronobacterium gregoryi SP2 |
| 34 | 1170915 | 1171085 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 35 | 486137 | 486307 | + | NZ_CP069188.1 | Haloterrigena salifodinae |
| 36 | 2712608 | 2712778 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 37 | 1269685 | 1269855 | - | NC_019964.1 | Halovivax ruber XH-70 |
| 38 | 537609 | 537779 | + | NZ_CP019327.1 | Haloterrigena daqingensis |
| 39 | 579788 | 579955 | - | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 40 | 2274259 | 2274429 | - | NZ_CP019154.1 | Haloarcula taiwanensis |
| 41 | 566421 | 566591 | - | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 42 | 303840 | 304010 | + | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 43 | 2291427 | 2291597 | - | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 44 | 1660010 | 1660180 | - | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 45 | 229086 | 229256 | - | NZ_LN831302.1 | Halobacterium hubeiense |
| 46 | 2933873 | 2934040 | + | NC_013202.1 | Halomicrobium mukohataei DSM 12286 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013967.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF19104.2 | 0.69 | 31 | 3289 | opposite-strand | Family of unknown function (DUF5791) |
| 2 | PF13460.8 | 0.73 | 33 | 2392 | opposite-strand | NAD(P)H-binding |
| 3 | PF01368.22 | 0.76 | 34 | 1159.0 | opposite-strand | DHH family |
| 4 | PF00293.30 | 0.69 | 31 | 1950.0 | opposite-strand | NUDIX domain |
++ More..