Result : HVO_0649
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | HVO_0649 |
| NCBI Accession ID | CP001956.1 |
| Organism | Haloferax volcanii DS2 |
| Left | 582834 |
| Right | 583040 |
| Strand | - |
| Nucleotide Sequence | ATGTCAATTGGAAGGACGCCGAGAGGAACGACCGCGTTGGACCGGTTGCGGGAGCGATACAGCGACGCTGACCTCACCTGTTCGAAATGTGGCTTCACCGACGACGGCGGCGAGTGGTCGGCCAAGACGACCGGGTCGAGCGTGTTCTACCGGCGGGTCTGTCCGAGTTGCGGCGCAATCGAGACGCGGACGCTCTCGCTGAAGTAG |
| Sequence | MSIGRTPRGTTALDRLRERYSDADLTCSKCGFTDDGGEWSAKTTGSSVFYRRVCPSCGAIETRTLSLK |
| Source of smORF | Literature-mining |
| Function | The deletion mutant is inhibited in its ability to swarm and grow in the presence of bile acids. |
| Pubmed ID | 31083437 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 582834 | 583040 | - | NC_013967.1 | Haloferax volcanii DS2 |
| 2 | 632669 | 632875 | - | NZ_CP048738.1 | Haloferax alexandrinus |
| 3 | 574907 | 575113 | - | NZ_CP011947.1 | Haloferax gibbonsii |
| 4 | 1222542 | 1222751 | - | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 5 | 735767 | 735946 | - | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 6 | 372938 | 373132 | + | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 7 | 2209637 | 2209807 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013967.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11419.10 | 0.71 | 5 | 181 | same-strand | Protein of unknown function (DUF3194) |
| 2 | PF01920.22 | 0.71 | 5 | 439 | same-strand | Prefoldin subunit |
| 3 | PF09341.12 | 0.71 | 5 | 872 | same-strand | Transcription factor Pcc1 |
| 4 | PF03604.15 | 0.71 | 5 | 1143 | same-strand | DNA directed RNA polymerase, 7 kDa subunit |
| 5 | PF01780.21 | 0.71 | 5 | 1312 | same-strand | Ribosomal L37ae protein family |
++ More..