Result : High-light_Inducible_Protein
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | High-light_Inducible_Protein |
| NCBI Accession ID | NC_000911.1 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 398188 |
| Right | 398361 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGAAGAACTACAACCGAACCAAACCCCCGTGCAGGAAGATCCCAAATTTGGCTTCAACAACTACGCGGAAAAGCTCAATGGCCGGGCTGCCATGGTGGGATTTCTCCTCATCCTGGTGATCGAATATTTCACTAACCAAGGGGTGTTGGCCTGGTTGGGACTGCGCTAG |
| Sequence | MSEELQPNQTPVQEDPKFGFNNYAEKLNGRAAMVGFLLILVIEYFTNQGVLAWLGLR |
| Source of smORF | Literature-mining |
| Function | This protein belongs to a family of small proteins that are induced under high light conditions. HliA and HliB associate with trimeric Photosytem I complexes and Slr1128 protein. HliC associates with PsaL and TMP14. The loss of function mutants show decrease in number of trimeric PS I complexes. Therefore, the small proteins are required for stabilisation of PS I trimers and protection of cells under high light. |
| Pubmed ID | 18502976 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1980099 | 1980269 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 2 | 3060167 | 3060337 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 3 | 861221 | 861391 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 4 | 3651303 | 3651473 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 5 | 5030690 | 5030860 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 6 | 1521713 | 1521883 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 7 | 2738088 | 2738264 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 8 | 4057722 | 4057892 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 9 | 2645760 | 2645930 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 5009327 | 5009497 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 11 | 2277785 | 2277955 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 12 | 675759 | 675929 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 13 | 5736794 | 5736964 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 14 | 1740157 | 1740327 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 15 | 2312495 | 2312671 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 16 | 3032102 | 3032275 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 17 | 221765 | 221935 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 18 | 4626027 | 4626197 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 19 | 2607464 | 2607634 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 20 | 2006138 | 2006317 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 21 | 3288865 | 3289035 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 22 | 1289002 | 1289181 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 23 | 898525 | 898689 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 24 | 1219272 | 1219445 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 25 | 1883978 | 1884151 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 26 | 2005497 | 2005670 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 27 | 189785 | 189949 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 28 | 4467126 | 4467269 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 29 | 1545463 | 1545621 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 30 | 2873327 | 2873488 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
++ More..