Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP008971.1 |
Organism | Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) (Peptostreptococcus magnus) |
Left | 910112 |
Right | 910348 |
Strand | - |
Nucleotide Sequence | ATGAATGAATACAGAGAATATGACGAAGGATTGAAAAGGCTTAGTGAAATCGTTGAAAAATTAGAAGATAGAGAGTTAAGCCTTGAAGAAAATATAAAGTTATACGAAGAAGGCATGAAACTTCACAAAAGATTAAGTTCTATTTTAAAAGAACAAGAAGGTAAAATGACCTTGATTAAGGATAACAAAGAAGAAGATTTTCAAATAAATATGCTTTTAAGTGATGATAATGAATAA |
Sequence | MNEYREYDEGLKRLSEIVEKLEDRELSLEENIKLYEEGMKLHKRLSSILKEQEGKMTLIKDNKEEDFQINMLLSDDNE |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 18263572 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | B0S1L9 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2314266 | 2314460 | + | NC_014393.1 | Clostridium cellulovorans 743B |
2 | 1275156 | 1275386 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03780.15 | 1.0 | 2 | 2515.5 | same-strand | Asp23 family, cell envelope-related function |
2 | PF01029.20 | 1.0 | 2 | 1657.5 | same-strand | NusB family |
3 | PF13742.8 | 1.0 | 2 | 0.5 | same-strand | OB-fold nucleic acid binding domain |
4 | PF01336.27 | 1.0 | 2 | 0.5 | same-strand | OB-fold nucleic acid binding domain |
5 | PF00348.19 | 1.0 | 2 | 3.5 | same-strand | Polyprenyl synthetase |
6 | PF01728.21 | 1.0 | 2 | 2571.5 | same-strand | FtsJ-like methyltransferase |
7 | PF01479.27 | 1.0 | 2 | 2571.5 | same-strand | S4 domain |
8 | PF20143.1 | 1.0 | 2 | 3638.0 | same-strand | ATP-NAD kinase C-terminal domain |