Result : B0S1L9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP008971.1 |
| Organism | Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) (Peptostreptococcus magnus) |
| Left | 910112 |
| Right | 910348 |
| Strand | - |
| Nucleotide Sequence | ATGAATGAATACAGAGAATATGACGAAGGATTGAAAAGGCTTAGTGAAATCGTTGAAAAATTAGAAGATAGAGAGTTAAGCCTTGAAGAAAATATAAAGTTATACGAAGAAGGCATGAAACTTCACAAAAGATTAAGTTCTATTTTAAAAGAACAAGAAGGTAAAATGACCTTGATTAAGGATAACAAAGAAGAAGATTTTCAAATAAATATGCTTTTAAGTGATGATAATGAATAA |
| Sequence | MNEYREYDEGLKRLSEIVEKLEDRELSLEENIKLYEEGMKLHKRLSSILKEQEGKMTLIKDNKEEDFQINMLLSDDNE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 18263572 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | B0S1L9 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2314266 | 2314460 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 2 | 1275156 | 1275386 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014393.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03780.15 | 1.0 | 2 | 2515.5 | same-strand | Asp23 family, cell envelope-related function |
| 2 | PF01029.20 | 1.0 | 2 | 1657.5 | same-strand | NusB family |
| 3 | PF13742.8 | 1.0 | 2 | 0.5 | same-strand | OB-fold nucleic acid binding domain |
| 4 | PF01336.27 | 1.0 | 2 | 0.5 | same-strand | OB-fold nucleic acid binding domain |
| 5 | PF00348.19 | 1.0 | 2 | 3.5 | same-strand | Polyprenyl synthetase |
| 6 | PF01728.21 | 1.0 | 2 | 2571.5 | same-strand | FtsJ-like methyltransferase |
| 7 | PF01479.27 | 1.0 | 2 | 2571.5 | same-strand | S4 domain |
| 8 | PF20143.1 | 1.0 | 2 | 3638.0 | same-strand | ATP-NAD kinase C-terminal domain |
++ More..