Result : NblA2

Protein Information

• Protein name: NblA2
• NCBI Accession ID: AP012278.1
• Organism: Synechocystis sp. PCC 6803
• Left: 1522555
• Right: 1522737
• Strand: -
• Nucleotide Sequence: ATGATCAACAACGAAGCCTTTAACCTATCCTTAGAGCAGAAATTTCAACTGCAGTGTTTGCAACAGGAATATCAAGAACTAGACCGGGAGCAGACCGTTAACTATTTACTAGAAACCATGCAACAAATCATGGTGCGGGATAACCTGATCCGGGATTTGATGAAAAATTCACTCCTCCCCTAG
• Sequence: MINNEAFNLSLEQKFQLQCLQQEYQELDREQTVNYLLETMQQIMVRDNLIRDLMKNSLLP
• Source of smORF: Literature-mining
• Function: It is responsible for the degradation of phycobilisomes (light harvesting complexes) during nitrogen deficiency. The gene is Synechocystis sp. PCC6803 NblA codes for two proteins, NblA1 and NblA2, both of which heterodimerise and form a ternary complex with ClpC protease and phycobiliproteins. This complex is susceptible to ATP-dependent degradation by ClpC protease.
• Pubmed ID: 24610785
• Domain: CDD:398271
• Functional Category: Regulator
• Uniprot ID: P73890
• ORF Length (Amino Acid): 60

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3266776	3266943	+	NC_019748.1	Stanieria cyanosphaera PCC 7437
2	1384219	1384365	+	NC_019693.1	Oscillatoria acuminata PCC 6304

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_019748.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00427.23	1.0	2	1473.5	opposite-strand	Phycobilisome Linker polypeptide
2	PF09367.12	1.0	2	299.5	opposite-strand	CpeS-like protein
3	PF13424.8	1.0	2	2407.0	both-strands	Tetratricopeptide repeat