Result : NblA1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NblA1 |
| NCBI Accession ID | AP012278.1 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 1522824 |
| Right | 1523012 |
| Strand | - |
| Nucleotide Sequence | ATGAAACCTGAATCCTTCGATCTCACCATTGAACAAATGTTTGAGTTCCGTCGCATGCAGGATGCCACCGCCAACATCAGCCAGGAGCAAGCCCTGGAACTTTTGGTCCAAGCCTCTCGACTGTTGATGATTAAATCCAACGTCATCCGGGACTTAATGCGCCAGGCTCCCCTGGAGCCCCTAGGTTAA |
| Sequence | MKPESFDLTIEQMFEFRRMQDATANISQEQALELLVQASRLLMIKSNVIRDLMRQAPLEPLG |
| Source of smORF | Literature-mining |
| Function | It is responsible for the degradation of phycobilisomes (light harvesting complexes) during nitrogen deficiency. The gene is Synechocystis sp. PCC6803 NblA codes for two proteins, NblA1 and NblA2, both of which heterodimerise and form a ternary complex with ClpC protease and phycobiliproteins. This complex is susceptible to ATP-dependent degradation by ClpC protease. |
| Pubmed ID | 24610785 |
| Domain | CDD:398271 |
| Functional Category | Regulator |
| Uniprot ID | P73891 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 919201 | 919401 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 2 | 393763 | 393948 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 3 | 31799 | 31984 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 4 | 2130942 | 2131127 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00132.26 | 0.75 | 3 | 204 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
| 2 | PF04613.16 | 0.75 | 3 | 204 | opposite-strand | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD |
++ More..