| Protein name |
NdhQ |
| NCBI Accession ID |
CP047958.1 |
| Organism |
Synechococcus sp. MIT S9220 |
| Left |
696992 |
| Right |
697117 |
| Strand |
+ |
| Nucleotide Sequence |
GTGGCGATGGAGAACGGTGGATCAGAAAGCACGATGCACGTTTTGGTGTGGGGCATCGGTCTTCTCGGTGGCATCGGCGTTTTCATCGTGTGGGGCCTGACCAACGCCTATCCGGCGGTGTCCTGA |
| Sequence |
MAMENGGSESTMHVLVWGIGLLGGIGVFIVWGLTNAYPAVS |
| Source of smORF |
Literature-mining |
| Function |
It is a part of cyanobacterial large NAD(P)H dehydrogenase (NDH-1). It forms a stabilising subunit. Deletion of this gene disassembles half of large NDH-1 complex to medium complex(NDH-1M). In the background of NdhP deletion, the deletion of NdhQ leads to complete disassembly of NDH-1L to NDH-1M. |
| Pubmed ID |
25873552
|
| Domain |
|
| Functional Category |
Regulator |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
41 |