Result : NdhP
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NdhP |
| NCBI Accession ID | PDB: 6NBY_P |
| Organism | Thermosynechococcus elongatus BP-1 |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MDAVISVKPILLAMTPVFILLCLFFGTRNGFYDTDQYHGNGSAH |
| Source of smORF | Literature-mining |
| Function | It is a part of cyanobacterial large NAD(P)H dehydrogenase (NDH-1). It forms a stabilising subunit. The C-terminal tail of this protein is essential for the assembly of NdhD1 and NdhF1 and the stabilisation of the complex. |
| Pubmed ID | 24847053 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1189462 | 1189596 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 2 | 160868 | 161002 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 3 | 549395 | 549529 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 2723024 | 2723146 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 5 | 910906 | 911028 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 6 | 4044355 | 4044477 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 7 | 5585896 | 5586018 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 8 | 1593107 | 1593229 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 9 | 3158391 | 3158513 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 10 | 3842421 | 3842543 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 11 | 3313493 | 3313615 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 12 | 1692180 | 1692302 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 13 | 3131573 | 3131695 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 14 | 4488676 | 4488798 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 15 | 5225615 | 5225737 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 16 | 1154496 | 1154618 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 17 | 1078245 | 1078367 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 18 | 6287124 | 6287246 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 19 | 3869777 | 3869899 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 20 | 1530429 | 1530551 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 21 | 4152859 | 4152978 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 22 | 788472 | 788582 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 23 | 1145991 | 1146101 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 24 | 4798947 | 4799069 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 25 | 2119139 | 2119261 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 26 | 2877247 | 2877357 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 27 | 4028304 | 4028423 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 28 | 1840097 | 1840234 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 29 | 4911556 | 4911678 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004113.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12706.9 | 0.69 | 20 | 135.5 | same-strand | Beta-lactamase superfamily domain |
++ More..