Result : NdhS
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NdhS |
| NCBI Accession ID | NC_005042.1 |
| Organism | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| Left | 1617963 |
| Right | 1618148 |
| Strand | - |
| Nucleotide Sequence | TTGAATAATTCAGAAGGCATTATCTTGCCTGGATCTTCAGTCAAGGTTAATAACCCTAGTTCCATTTACAATGGATATAAAGGTTTTGTTCAGCGTATTGCGGAAAATAAAGCAGCTGTGCTTTTTGAAGGTGGTAATTGGGATAAATTATTAACCATTCCTATCAATGAATTGGAATTGGTTTAG |
| Sequence | MNNSEGIILPGSSVKVNNPSSIYNGYKGFVQRIAENKAAVLFEGGNWDKLLTIPINELELV |
| Source of smORF | Literature-mining |
| Function | This protein is a novel subunit of cyanobacterial type 1 NAD(P)H dehydrogenase (NDH-1). Deletion of this gene significantly impairs NDH-CET activity and retarded cell growth under high light conditions. It contains a Src homology 3-like domain and may provide for the binding between NDH-1 and an electron donor. |
| Pubmed ID | 21880717 |
| Domain | CDD:402977 |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1617963 | 1618148 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 2108949 | 2109128 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 3 | 3599902 | 3600099 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 4 | 1049067 | 1049264 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 5 | 947490 | 947678 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 6 | 6396053 | 6396250 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 7 | 2500096 | 2500293 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 8 | 1283078 | 1283269 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 9 | 1645780 | 1645977 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 10 | 2713260 | 2713454 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 11 | 5540070 | 5540240 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 12 | 4607237 | 4607401 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 13 | 5536495 | 5536662 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 14 | 3437802 | 3437996 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 15 | 619542 | 619724 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 16 | 643722 | 643904 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 17 | 3294839 | 3295036 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 18 | 4298308 | 4298502 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 19 | 6733904 | 6734101 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 20 | 103082 | 103276 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 21 | 1729511 | 1729705 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 22 | 5719233 | 5719427 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 23 | 2528457 | 2528648 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 24 | 771051 | 771242 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 25 | 4229367 | 4229558 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 26 | 721919 | 722086 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 27 | 1442361 | 1442519 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 28 | 2856940 | 2857128 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09378.12 | 0.79 | 22 | 94.5 | same-strand | HAS barrel domain |
++ More..