Result : GndA
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | GndA |
| NCBI Accession ID | NC_000913.3 |
| Organism | E.coli K12 substr. MG1655 |
| Left | 2100863 |
| Right | 2100973 |
| Strand | - |
| Nucleotide Sequence | ATGGTGGTAACACCTTCTTCCAGGACACTATTCGTCGTAATCGTGAGCTTTCAGCAGAGGGCTTTAACTTCATCGGTACCGGTGTTTCTGGCGGTGAAGAGGGGGCGCTGA |
| Sequence | MVVTPSSRTLFVVIVSFQQRALTSSVPVFLAVKRGR |
| Source of smORF | Literature-mining |
| Function | It is a 36 amino acids heat shock protein which completely overlaps gnd gene in alternate reading frame. It is shown to co-fractionate with cell membrane. |
| Pubmed ID | 29039649 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2100863 | 2100973 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2107242 | 2107352 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1555412 | 1555522 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 4246334 | 4246444 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 5 | 2773062 | 2773172 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1088505 | 1088615 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 2978831 | 2978941 | - | NC_015968.1 | Enterobacter soli |
| 8 | 2653796 | 2653906 | - | NZ_LR134340.1 | Escherichia marmotae |
| 9 | 785848 | 785958 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 10 | 4942811 | 4942921 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 11 | 1649392 | 1649502 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 12 | 2947320 | 2947430 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 13 | 3252576 | 3252686 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 14 | 1756657 | 1756767 | - | NZ_CP041247.1 | Raoultella electrica |
| 15 | 1693880 | 1693990 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 16 | 483656 | 483766 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 2288270 | 2288380 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 18 | 815399 | 815509 | - | NZ_CP033744.1 | Citrobacter freundii |
| 19 | 1617836 | 1617946 | + | NZ_CP023525.1 | Cedecea neteri |
| 20 | 3041461 | 3041571 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 21 | 2994098 | 2994208 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 22 | 1670708 | 1670818 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 23 | 2737133 | 2737243 | - | NZ_CP061511.1 | Mixta calida |
| 24 | 2076608 | 2076718 | - | NZ_AP014857.1 | Escherichia albertii |
| 25 | 2754920 | 2755030 | - | NZ_CP015581.1 | Tatumella citrea |
| 26 | 404 | 514 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 27 | 1436585 | 1436695 | + | NZ_CP038853.1 | Pantoea vagans |
| 28 | 2160359 | 2160469 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 29 | 4282227 | 4282337 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 30 | 441112 | 441222 | + | NZ_CP038469.1 | Citrobacter tructae |
| 31 | 731779 | 731889 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 32 | 1755216 | 1755326 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 1567963 | 1568076 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 34 | 1738292 | 1738402 | + | NZ_CP054254.1 | Klebsiella variicola |
| 35 | 995457 | 995567 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 3105031 | 3105141 | - | NZ_LS483422.1 | Providencia heimbachae |
| 37 | 5435314 | 5435424 | - | NZ_CP026047.1 | Raoultella planticola |
| 38 | 3315244 | 3315354 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 39 | 3021844 | 3021954 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 40 | 2570723 | 2570833 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 41 | 1753135 | 1753245 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 42 | 700642 | 700752 | + | NZ_CP067057.1 | Rahnella aceris |
| 43 | 2824995 | 2825105 | - | NZ_CP050150.1 | Hafnia alvei |
| 44 | 3561111 | 3561221 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 45 | 2344256 | 2344366 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 46 | 1511989 | 1512099 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 47 | 3248557 | 3248664 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 48 | 4562201 | 4562308 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 49 | 4360643 | 4360753 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 50 | 3117312 | 3117422 | + | NZ_CP065640.1 | Serratia rubidaea |
| 51 | 1402685 | 1402795 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 52 | 1690074 | 1690184 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 53 | 71750 | 71860 | + | NZ_CP009787.1 | Yersinia rohdei |
| 54 | 1637236 | 1637346 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 55 | 2181656 | 2181766 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 56 | 1919803 | 1919913 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 57 | 3148319 | 3148429 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 58 | 3359941 | 3360051 | - | NZ_CP071320.1 | Serratia ureilytica |
| 59 | 2366185 | 2366298 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 60 | 2632158 | 2632268 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 61 | 713701 | 713811 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 62 | 1262875 | 1262985 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 63 | 166512 | 166622 | - | NZ_CP053416.1 | Salmonella bongori |
| 64 | 676763 | 676873 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 65 | 3586630 | 3586740 | + | NZ_CP007230.1 | Yersinia similis |
| 66 | 466988 | 467098 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 67 | 626819 | 626926 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 68 | 190819 | 190929 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 69 | 3123360 | 3123470 | + | NZ_CP019706.1 | Pantoea alhagi |
| 70 | 3068284 | 3068394 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 71 | 2064309 | 2064419 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 72 | 2672717 | 2672827 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 73 | 1496275 | 1496385 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 74 | 2734044 | 2734154 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 75 | 1649238 | 1649345 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 76 | 2407688 | 2407798 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 77 | 1312316 | 1312426 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 78 | 1700676 | 1700783 | + | NZ_LR134494.1 | Serratia quinivorans |
| 79 | 3886045 | 3886152 | + | NZ_CP011254.1 | Serratia fonticola |
| 80 | 1522526 | 1522636 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 81 | 3585777 | 3585887 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 82 | 2720845 | 2720955 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 83 | 1770373 | 1770483 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 84 | 1864851 | 1864961 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01502.20 | 0.71 | 59 | 3637.0 | opposite-strand | Phosphoribosyl-AMP cyclohydrolase |
| 2 | PF01503.19 | 0.71 | 59 | 3637.0 | opposite-strand | Phosphoribosyl-ATP pyrophosphohydrolase |
| 3 | PF00393.21 | 0.99 | 82 | -110 | same-strand | 6-phosphogluconate dehydrogenase, C-terminal domain |
| 4 | PF03446.17 | 1.0 | 83 | -110.0 | same-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
++ More..