Result : FtsWs
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FtsWs |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter crescentus NA1000 |
| Left | 2786329 |
| Right | 2786436 |
| Strand | - |
| Nucleotide Sequence | ATGCTCGCGATGGGACTAACGCTGGGCATGGCCCTGGCCTTGTTGCGCAAACGCCCCGGCGCCTATGGCGCGAGCGGCGAGTTCGGCTTCGGTCGCGCGGACGCCTGA |
| Sequence | MLAMGLTLGMALALLRKRPGAYGASGEFGFGRADA |
| Source of smORF | Literature-mining |
| Function | It causes a marked motility and cell division phenotype in a low agar swarming plate assay and an increase in cell length when overexpressed. The protein can localise to the sites of constriction, may play a role in cell division. |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2786329 | 2786436 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1303599 | 1303706 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 3 | 679960 | 680067 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 4 | 1007970 | 1008077 | + | NZ_CP013002.1 | Caulobacter henricii |
| 5 | 960335 | 960433 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048815.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01225.27 | 0.8 | 4 | 3659 | same-strand | Mur ligase family, catalytic domain |
| 2 | PF08245.14 | 1.0 | 5 | 3743.0 | same-strand | Mur ligase middle domain |
| 3 | PF02875.23 | 1.0 | 5 | 5006 | same-strand | Mur ligase family, glutamate ligase domain |
| 4 | PF04101.18 | 1.0 | 5 | 14 | same-strand | Glycosyltransferase family 28 C-terminal domain |
| 5 | PF03033.22 | 1.0 | 5 | 14 | same-strand | Glycosyltransferase family 28 N-terminal domain |
| 6 | PF00953.23 | 1.0 | 5 | 2744 | same-strand | Glycosyl transferase family 4 |
| 7 | PF00905.24 | 0.6 | 3 | 6678 | same-strand | Penicillin binding protein transpeptidase domain |
++ More..