Result : PepA2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PepA2 |
| NCBI Accession ID | WP_000482650.1 |
| Organism | Staphylococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK |
| Source of smORF | Literature-mining |
| Function | 35 amino acid type-1 toxin protein part of SprA2/SprA2AS module . The cis enocoded RNA SprA2AS acts in trans to prevent ribosome loading on the toxin m RNA . The toxin causes cell death internally.and when in extracellular medium, it is toxic to neutrophils and erythrocytes. |
| Pubmed ID | 30544243 |
| Domain | CDD:411230 |
| Functional Category | Toxin type 1 |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2502610 | 2502717 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2463912 | 2464019 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1142013 | 1142117 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 56639 | 56734 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 5 | 2505476 | 2505571 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 6 | 25581 | 25682 | - | NZ_CP033731.1 | Staphylococcus hominis |
| 7 | 7923 | 8018 | - | NZ_CP033731.1 | Staphylococcus hominis |
| 8 | 5662 | 5763 | + | NZ_CP035289.1 | Staphylococcus epidermidis |
| 9 | 1054553 | 1054654 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 10 | 1108525 | 1108629 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 299521 | 299616 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 12 | 310349 | 310444 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 13 | 84435 | 84536 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 14 | 331830 | 331925 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 15 | 72182 | 72277 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 16 | 1174126 | 1174221 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 17 | 2113159 | 2113260 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 18 | 372304 | 372405 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 19 | 2457843 | 2457938 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 20 | 49946 | 50041 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 21 | 20417 | 20527 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 22 | 362481 | 362576 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 23 | 1049602 | 1049706 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 24 | 988440 | 988535 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 25 | 79842 | 79934 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 26 | 38709 | 38807 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 27 | 2088445 | 2088540 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 28 | 39178 | 39276 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 29 | 257828 | 257926 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 30 | 2504754 | 2504849 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 31 | 1604178 | 1604273 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 32 | 416428 | 416523 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 33 | 1013315 | 1013410 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 34 | 24200 | 24295 | + | NZ_CP022047.2 | Mammaliicoccus sciuri |
| 35 | 2274935 | 2275027 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 36 | 47060 | 47158 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 37 | 726484 | 726576 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
++ More..