Result : BlpC
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | BlpC |
| NCBI Accession ID | WP_000358817.1 |
| Organism | Streptococcus pneumoniae |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MDKKQNLTSFQELTTTELNQITGGGWWEELLHETILSKFKITKALELPIQL |
| Source of smORF | Literature-mining |
| Function | Encodes an autoinducer peptide responsible for the differential expression of 16 genes in Streptococcus pneumoniae. It has a di-gly motif. |
| Pubmed ID | 10940007 |
| Domain | CDD:383496 |
| Functional Category | Quorum sensing |
| Uniprot ID | |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1420600 | 1420755 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 2 | 1702070 | 1702225 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 3 | 564629 | 564778 | + | NZ_CP012805.1 | Streptococcus anginosus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012805.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02517.18 | 0.67 | 2 | 3265.5 | opposite-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 2 | PF00664.25 | 1.0 | 3 | 1429 | same-strand | ABC transporter transmembrane region |
| 3 | PF03412.17 | 1.0 | 3 | 1429 | same-strand | Peptidase C39 family |
| 4 | PF00005.29 | 1.0 | 3 | 1429 | same-strand | ABC transporter |
| 5 | PF13437.8 | 1.0 | 3 | 57 | same-strand | HlyD family secretion protein |
| 6 | PF14501.8 | 1.0 | 3 | 45 | opposite-strand | GHKL domain |
| 7 | PF04397.17 | 1.0 | 3 | 1399 | opposite-strand | LytTr DNA-binding domain |
| 8 | PF00072.26 | 1.0 | 3 | 1397 | opposite-strand | Response regulator receiver domain |
| 9 | PF10439.11 | 0.67 | 2 | 3541.0 | both-strands | Bacteriocin class II with double-glycine leader peptide |
++ More..