Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AP008971.1 |
Organism | Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) (Peptostreptococcus magnus) |
Left | 721840 |
Right | 722037 |
Strand | + |
Nucleotide Sequence | ATGATTAATCCATCATTTAAAAAATTATCAGAAATAAATAATAGTAGATATGCACTTTGTGTAATGGTAAGTAAAAGAGCAAGAATGCTAATAGACGGAAAAGAAACTAAATTAAAAAAAGCAAAAGCCCAACCAGTTACTACAGCTTTGGAAGAAGTTATGGAAAAGAAGGTTTGGGAAGATAAATCAAATGAATAA |
Sequence | MINPSFKKLSEINNSRYALCVMVSKRARMLIDGKETKLKKAKAQPVTTALEEVMEKKVWEDKSNE |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 18263572 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | B0S136 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 622280 | 622477 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
2 | 1228576 | 1228785 | - | NZ_LT632322.1 | Murdochiella vaginalis |
3 | 1628203 | 1628391 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
4 | 1013313 | 1013501 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
5 | 1287868 | 1288056 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
6 | 1307166 | 1307363 | - | NZ_CP009761.1 | Parvimonas micra |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05833.13 | 0.83 | 5 | 698 | opposite-strand | NFACT N-terminal and middle domains |
2 | PF05670.15 | 0.83 | 5 | 698 | opposite-strand | NFACT protein RNA binding domain |
3 | PF00625.23 | 1.0 | 6 | 0.0 | same-strand | Guanylate kinase |
4 | PF13238.8 | 1.0 | 6 | 0.0 | same-strand | AAA domain |
5 | PF04127.17 | 1.0 | 6 | 1.5 | same-strand | DNA / pantothenate metabolism flavoprotein |
6 | PF02441.21 | 1.0 | 6 | 1.5 | same-strand | Flavoprotein |
7 | PF18074.3 | 0.83 | 5 | 1179 | same-strand | Primosomal protein N C-terminal domain |
8 | PF00270.31 | 1.0 | 6 | 1178.0 | same-strand | DEAD/DEAH box helicase |
9 | PF18319.3 | 1.0 | 6 | 1178.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
10 | PF04851.17 | 1.0 | 6 | 1178.0 | same-strand | Type III restriction enzyme, res subunit |
11 | PF17764.3 | 1.0 | 6 | 1178.0 | same-strand | 3'DNA-binding domain (3'BD) |
12 | PF18297.3 | 0.67 | 4 | 698.0 | opposite-strand | NFACT protein RNA binding domain |