Protein name |
FsrD |
NCBI Accession ID |
HG794359.1 |
Organism |
Enterococcus faecalis |
Left |
1484 |
Right |
1645 |
Strand |
+ |
Nucleotide Sequence |
ATGAAATTTGGTAAAAAAATAATTAAAAATGTTATTGAAAAAAGAGTTGCAAAAGTTAGTGATGGTGTGGGAACTAAGCCTAGATTAAATCAAAATTCGCCCAATATATTTGGACAATGGATGGGACAAACTGAAAAACCTAAAAAGAATATTGAAAAATGA |
Sequence |
MKFGKKIIKNVIEKRVAKVSDGVGTKPRLNQNSPNIFGQWMGQTEKPKKNIEK |
Source of smORF |
Literature-mining |
Function |
In frame with FsrB but translated independently as a separate ORF. The small ORF encodes precusor of gelatinase-biosynthesis activating pheromone propeptide. |
Pubmed ID |
16980448
|
Domain |
|
Functional Category |
Quorum sensing |
Uniprot ID |
|
ORF Length (Amino Acid) |
53 |