| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NprX |
| NCBI Accession ID | WP_000738910.1 |
| Organism | Bacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKKMVFGVLAFILTLTVAGGIHQYSSKPDIVGQQAKTVEQVNL |
| Source of smORF | Literature-mining |
| Function | quorum sensing peptide that binds to NprR as a heptapeptide to regulate NprA transcription which is required for virulence and sporulation like activities. |
| Pubmed ID | 21958299 |
| Domain | CDD:424173 |
| Functional Category | Quorum sensing |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |