Protein Information |
Information Type | Description |
---|---|
Protein name | NprX |
NCBI Accession ID | WP_000738910.1 |
Organism | Bacillus |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MKKMVFGVLAFILTLTVAGGIHQYSSKPDIVGQQAKTVEQVNL |
Source of smORF | Literature-mining |
Function | quorum sensing peptide that binds to NprR as a heptapeptide to regulate NprA transcription which is required for virulence and sporulation like activities. |
Pubmed ID | 21958299 |
Domain | CDD:424173 |
Functional Category | Quorum sensing |
Uniprot ID | |
ORF Length (Amino Acid) | 43 |