Result : PapR
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PapR |
| NCBI Accession ID | WP_000734741.1 |
| Organism | Bacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKKLLIGSLLTLAMAWGISLTDTALEKSQVISHNDQEVQLASDLPFEY |
| Source of smORF | Literature-mining |
| Function | 48 amino acid protein. Responsible for PlcR regulon functions like virulence and haemolysis. Processed in the cell to a pentapeptide which binds to plcR. |
| Pubmed ID | 12198157 |
| Domain | CDD:399157 |
| Functional Category | Quorum sensing |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 70400 | 70546 | + | NZ_CP040336.1 | Bacillus luti |
| 2 | 5305818 | 5305964 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 3 | 5080975 | 5081121 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 5267579 | 5267725 | - | NC_011725.1 | Bacillus cereus B4264 |
| 5 | 5102073 | 5102219 | - | NZ_CP064875.1 | Bacillus toyonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01061.26 | 1.0 | 5 | 3420 | same-strand | ABC-2 type transporter |
| 2 | PF12730.9 | 0.8 | 4 | 3406.5 | same-strand | ABC-2 family transporter protein |
| 3 | PF07730.15 | 1.0 | 5 | 2289 | same-strand | Histidine kinase |
| 4 | PF00072.26 | 1.0 | 5 | 1690 | same-strand | Response regulator receiver domain |
| 5 | PF00196.21 | 1.0 | 5 | 1690 | same-strand | Bacterial regulatory proteins, luxR family |
| 6 | PF08281.14 | 1.0 | 5 | 1690 | same-strand | Sigma-70, region 4 |
| 7 | PF04545.18 | 1.0 | 5 | 1690 | same-strand | Sigma-70, region 4 |
| 8 | PF18768.3 | 0.8 | 4 | 89.0 | same-strand | RNPP family C-terminal domain |
| 9 | PF01381.24 | 1.0 | 5 | 89 | same-strand | Helix-turn-helix |
| 10 | PF13424.8 | 0.6 | 3 | 89 | same-strand | Tetratricopeptide repeat |
| 11 | PF13321.8 | 1.0 | 5 | 17 | opposite-strand | Domain of unknown function (DUF4084) |
| 12 | PF00563.22 | 1.0 | 5 | 17 | opposite-strand | EAL domain |
| 13 | PF00990.23 | 1.0 | 5 | 17 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 14 | PF00989.27 | 1.0 | 5 | 17 | opposite-strand | PAS fold |
| 15 | PF13426.9 | 1.0 | 5 | 17 | opposite-strand | PAS domain |
| 16 | PF03851.16 | 1.0 | 5 | 2823 | opposite-strand | UV-endonuclease UvdE |
| 17 | PF13091.8 | 1.0 | 5 | 3808 | opposite-strand | PLD-like domain |
| 18 | PF00614.24 | 1.0 | 5 | 3808 | opposite-strand | Phospholipase D Active site motif |
| 19 | PF02754.18 | 1.0 | 5 | 5357 | same-strand | Cysteine-rich domain |
| 20 | PF13183.8 | 1.0 | 5 | 5357 | same-strand | 4Fe-4S dicluster domain |
| 21 | PF13237.8 | 1.0 | 5 | 5357 | same-strand | 4Fe-4S dicluster domain |
| 22 | PF12838.9 | 1.0 | 5 | 5357 | same-strand | 4Fe-4S dicluster domain |
| 23 | PF13187.8 | 1.0 | 5 | 5357 | same-strand | 4Fe-4S dicluster domain |
| 24 | PF00108.25 | 1.0 | 5 | 7533 | same-strand | Thiolase, N-terminal domain |
| 25 | PF02803.20 | 1.0 | 5 | 7533 | same-strand | Thiolase, C-terminal domain |
++ More..