Protein Information |
Information Type | Description |
---|---|
Protein name | LaoB |
NCBI Accession ID | NC_002695.2 |
Organism | E.coli O157:H7 str. Sakai |
Left | 5216097 |
Right | 5216222 |
Strand | + |
Nucleotide Sequence | ATGTTAAGACTGTGGGAGGGAGAATCTGTGGCAGGAACCGCCTCTGGTATAGGGGGAGGCGAAGATAGCATTATTTCCTCTCCCTCTTCTTCGCTGTACCAGATAACCGGCACCATTAATTTATAG |
Sequence | MLRLWEGESVAGTASGIGGGEDSIISSPSSSLYQITGTINL |
Source of smORF | Literature-mining |
Function | It is an overlapping smORF which is L-arginine responsive which reduces its expression. Mutating the smORF led to better growth under L - Arginine which indicates that it reduces growth in the presence of L-arginine. |
Pubmed ID | 29433444 |
Domain | CDD:411652 |
Functional Category | Others |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5216097 | 5216222 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 4361519 | 4361644 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 3779523 | 3779648 | - | NZ_AP014857.1 | Escherichia albertii |
4 | 387520 | 387630 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 937600 | 937716 | + | NZ_CP057657.1 | Escherichia fergusonii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00152.22 | 1.0 | 4 | 6803 | opposite-strand | tRNA synthetases class II (D, K and N) |
2 | PF01336.27 | 1.0 | 4 | 6803 | opposite-strand | OB-fold nucleic acid binding domain |
3 | PF00854.23 | 1.0 | 4 | 5108 | opposite-strand | POT family |
4 | PF07690.18 | 1.0 | 4 | 5108 | opposite-strand | Major Facilitator Superfamily |
5 | PF01276.22 | 1.0 | 4 | 2902 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
6 | PF03711.17 | 1.0 | 4 | 2902 | opposite-strand | Orn/Lys/Arg decarboxylase, C-terminal domain |
7 | PF03709.17 | 1.0 | 4 | 2902 | opposite-strand | Orn/Lys/Arg decarboxylase, N-terminal domain |
8 | PF13520.8 | 1.0 | 4 | 1488 | opposite-strand | Amino acid permease |
9 | PF18500.3 | 1.0 | 4 | -125 | opposite-strand | CadC C-terminal domain 1 |
10 | PF00486.30 | 1.0 | 4 | -125 | opposite-strand | Transcriptional regulatory protein, C terminal |
11 | PF00440.25 | 0.75 | 3 | 1089.0 | opposite-strand | Bacterial regulatory proteins, tetR family |
12 | PF00324.23 | 0.75 | 3 | 1488 | opposite-strand | Amino acid permease |