Result : BAB2_0574
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | BAB2_0574 |
| NCBI Accession ID | WP_002965972.1 |
| Organism | B.abortus 2308 |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNIRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQSAVFGR |
| Source of smORF | Literature-mining |
| Function | membrane protein, expressed highly during stationary phase, low pH and oxidative stress. Growth not affected in presence of L-Fucose. |
| Pubmed ID | 29967118 |
| Domain | CDD:420128 |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 647461 | 647598 | - | NC_009504.1 | Brucella ovis ATCC 25840 |
| 2 | 392797 | 392934 | + | NZ_LT605586.1 | Brucella inopinata |
| 3 | 647017 | 647154 | - | NC_013118.1 | Brucella microti CCM 4915 |
| 4 | 646112 | 646249 | - | NC_004311.2 | Brucella suis 1330 |
| 5 | 645382 | 645519 | - | NC_010104.1 | Brucella canis ATCC 23365 |
| 6 | 651517 | 651654 | + | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
| 7 | 635243 | 635380 | + | NC_022906.1 | Brucella ceti TE10759-12 |
| 8 | 570927 | 571064 | + | NC_007624.1 | Brucella abortus 2308 |
| 9 | 319774 | 319911 | + | NZ_CP022603.1 | [Ochrobactrum] quorumnocens |
| 10 | 862008 | 862145 | - | NZ_CP064062.1 | Brucella anthropi |
| 11 | 306052 | 306189 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 12 | 3532409 | 3532546 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 13 | 3534283 | 3534420 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 14 | 3865109 | 3865246 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 15 | 257007 | 257144 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 16 | 4043590 | 4043727 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 17 | 147109 | 147246 | - | NZ_CP013107.1 | Sinorhizobium americanum |
| 18 | 958194 | 958331 | - | NZ_CP059897.1 | Ciceribacter thiooxidans |
| 19 | 539965 | 540111 | + | NC_020062.1 | Rhizobium tropici CIAT 899 |
| 20 | 14506 | 14646 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 21 | 2662812 | 2662949 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 22 | 1085662 | 1085802 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009504.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01063.21 | 0.64 | 14 | 1324.5 | opposite-strand | Amino-transferase class IV |
++ More..