ProsmORF-pred
Result : B0KCF2
Protein Information
Information Type Description
Protein name UPF0291 protein Teth39_0326
NCBI Accession ID CP000924.1
Organism Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum)
Left 366008
Right 366235
Strand +
Nucleotide Sequence ATGATAACGAGAGAAATGATAGATAGAATAAATTTCCTTTATCACAAATCACAAACAGAAGGTTTAACAGAAGAGGAAAAAGAAGAGCAGAAAAGGCTGAGGCAAGAATACGTGAAAGAAATAAAAGAGAGAGTAAGAAGAGAATTAGAAAGTATTAAATATGCTAACAATAGTTGCGAACATTGTGGTCATGACCATCATCACCATCATCACCACCACAGACATTAA
Sequence MITREMIDRINFLYHKSQTEGLTEEEKEEQKRLRQEYVKEIKERVRRELESIKYANNSCEHCGHDHHHHHHHHRH
Source of smORF Swiss-Prot
Function
Pubmed ID
Domain
Functional Category Others
Uniprot ID B0KCF2
ORF Length (Amino Acid) 75
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 6
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 361425 361652 + NC_014964.1 Thermoanaerobacter brockii subsp. finnii Ako-1
2 2081270 2081485 - NC_013921.1 Thermoanaerobacter italicus Ab9
3 1985851 1986066 - NC_014209.1 Thermoanaerobacter mathranii subsp. mathranii str. A3
4 2015652 2015879 - NZ_CP009170.1 Thermoanaerobacter kivui
5 2349106 2349333 - NC_015958.1 Thermoanaerobacter wiegelii Rt8.B1
6 2972176 2972397 + NZ_CP022464.2 Enterocloster bolteae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_014964.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00326.23 0.67 4 824.0 same-strand Prolyl oligopeptidase family
2 PF07758.13 0.83 5 148 opposite-strand Protein of unknown function (DUF1614)
3 PF00202.23 0.83 5 21 same-strand Aminotransferase class-III
4 PF14595.8 0.83 5 1470 same-strand Thioredoxin
5 PF02867.17 0.83 5 2134 same-strand Ribonucleotide reductase, barrel domain
6 PF00317.23 0.83 5 2134 same-strand Ribonucleotide reductase, all-alpha domain
7 PF12637.9 0.83 5 2134 same-strand TSCPD domain
8 PF00990.23 0.83 5 4659 same-strand Diguanylate cyclase, GGDEF domain
9 PF01590.28 0.83 5 4659 same-strand GAF domain
10 PF13185.8 0.83 5 4659 same-strand GAF domain
11 PF13492.8 0.83 5 4659 same-strand GAF domain
++ More..