Result : LDP4

Protein Information

• Protein name: LDP4
• NCBI Accession ID: WP_020012863.1
• Organism: A.tumefaciens
• Sequence: MQKNQPLVAHALPDAVDRLFVTFGVWKTLKAVLVAALVPRAPPTDPADLPERLLVDIGLDPSRVKRRRDWEVPHWAPRF
• Source of smORF: Literature-mining
• Function: DUF1127 containing protein, increased after cold shock
• Pubmed ID: 29967118
• Functional Category: Others
• ORF Length (Amino Acid): 79

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1572009	1572248	-	NZ_CP061003.1	Agrobacterium tumefaciens
2	1479883	1480122	-	NZ_CP053856.1	Rhizobium pusense
3	129742	129981	+	NZ_CP048632.1	Rhizobium oryzihabitans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP061003.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00163.21	0.67	2	4943.5	same-strand	Ribosomal protein S4/S9 N-terminal domain
2	PF01479.27	0.67	2	4943.5	same-strand	S4 domain
3	PF03741.18	1.0	3	3583	opposite-strand	Integral membrane protein TerC family
4	PF00892.22	1.0	3	863	same-strand	EamA-like transporter family
5	PF01810.20	1.0	3	189	same-strand	LysE type translocator
6	PF00588.21	1.0	3	1194	same-strand	SpoU rRNA Methylase family
7	PF00180.22	1.0	3	2903	opposite-strand	Isocitrate/isopropylmalate dehydrogenase