Result : LDP2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | LDP2 |
| NCBI Accession ID | AE007869.2 |
| Organism | A.tumefaciens |
| Left | 1750385 |
| Right | 1750603 |
| Strand | + |
| Nucleotide Sequence | ATGACCATGATACATTATCTGCCGGCGACAAACCGCTCTTCACTCCGCCCGTCGCCCAGCGGCTGGCTTGATCGCCTATCCAGCCATTTTTCTGCCCGTTACGCGGAATGGCGCCGCGAAAGGATGCTTCGTGCACTGGAGGCATTGCCACCCGAAACATTGAAGGATATCGGATGGCCGACAACCGACACCACCCGCATACACGCCGTCCGCAAATGA |
| Sequence | MTMIHYLPATNRSSLRPSPSGWLDRLSSHFSARYAEWRRERMLRALEALPPETLKDIGWPTTDTTRIHAVRK |
| Source of smORF | Literature-mining |
| Function | DUF1127 containing protein, increased after heat shock |
| Pubmed ID | 29967118 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1371186 | 1371404 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 2 | 1369509 | 1369727 | + | NZ_CP053856.1 | Rhizobium pusense |
| 3 | 233831 | 234046 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09992.11 | 0.67 | 2 | 3392.5 | opposite-strand | Phosphodiester glycosidase |
| 2 | PF00126.29 | 1.0 | 3 | 282 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF12833.9 | 1.0 | 3 | 272 | same-strand | Helix-turn-helix domain |
| 4 | PF00165.25 | 1.0 | 3 | 272 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 5 | PF01965.26 | 1.0 | 3 | 272 | same-strand | DJ-1/PfpI family |
| 6 | PF01256.19 | 1.0 | 3 | 1548 | opposite-strand | Carbohydrate kinase |
| 7 | PF03853.17 | 1.0 | 3 | 1548 | opposite-strand | YjeF-related protein N-terminus |
| 8 | PF00543.24 | 1.0 | 3 | 3381 | same-strand | Nitrogen regulatory protein P-II |
| 9 | PF00120.26 | 1.0 | 3 | 3790 | same-strand | Glutamine synthetase, catalytic domain |
| 10 | PF03951.21 | 1.0 | 3 | 3790 | same-strand | Glutamine synthetase, beta-Grasp domain |
| 11 | PF00892.22 | 1.0 | 3 | 5299 | same-strand | EamA-like transporter family |
++ More..