Result : LDP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | LDP1 |
| NCBI Accession ID | WP_003515205.1 |
| Organism | A.tumefaciens |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRTAERKMELEFATGQQSDTLRRIAFGVASTVKTFVQRIYNRIVANGLTELDDRLLADIGLARSDVTNALNTGLLEDPTAHLTRAARTRSVTRFKTL |
| Source of smORF | Literature-mining |
| Function | DUF1127 containing protein, increased after cold shock |
| Pubmed ID | 29967118 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 298505 | 298798 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 2 | 1480981 | 1481274 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 3 | 301612 | 301893 | + | NZ_CP053856.1 | Rhizobium pusense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06629.14 | 1.0 | 3 | 5878 | same-strand | MltA-interacting protein MipA |
| 2 | PF01040.20 | 1.0 | 3 | 4656 | same-strand | UbiA prenyltransferase family |
| 3 | PF19596.1 | 1.0 | 3 | 4014 | opposite-strand | Family of unknown function (DUF6101) |
| 4 | PF06748.14 | 1.0 | 3 | 1208 | same-strand | Protein of unknown function (DUF1217) |
| 5 | PF03466.22 | 1.0 | 3 | 204 | opposite-strand | LysR substrate binding domain |
| 6 | PF00126.29 | 1.0 | 3 | 204 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 7 | PF04107.15 | 1.0 | 3 | 180 | opposite-strand | Glutamate-cysteine ligase family 2(GCS2) |
| 8 | PF04452.16 | 1.0 | 3 | 1671 | opposite-strand | RNA methyltransferase |
| 9 | PF01384.22 | 1.0 | 3 | 2423 | opposite-strand | Phosphate transporter family |
| 10 | PF05116.15 | 0.67 | 2 | 4818.5 | opposite-strand | Sucrose-6F-phosphate phosphohydrolase |
++ More..