ProsmORF-pred
Result : SDP2
Protein Information
Information Type Description
Protein name SDP2
NCBI Accession ID WP_003515516.1
Organism A.tumefaciens
Left
Right
Strand
Nucleotide Sequence
Sequence MNPIRIAKNWISYRRTINELGSLSNQALSDIGLTRYDIRNVASRSFR
Source of smORF Literature-mining
Function DUF1127 protein, upregulated after heat shock, plays a role in cell aggregation and biofilm formation. The mutant shows increased glycine/serine( c1 metabolism) conversion, increased phosphate acquisition and increased denitrification (nitrate respiration).
Pubmed ID 29967118
Domain CDD:420128
Functional Category Others
Uniprot ID
ORF Length (Amino Acid) 47
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 43
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 468644 468787 - NZ_CP048632.1 Rhizobium oryzihabitans
2 469267 469413 - NZ_CP048632.1 Rhizobium oryzihabitans
3 1271560 1271703 + NZ_CP061003.1 Agrobacterium tumefaciens
4 1270528 1270671 + NZ_CP053856.1 Rhizobium pusense
5 2600173 2600316 - NZ_CP049241.1 Rhizobium pseudoryzae
6 2600579 2600725 - NZ_CP049241.1 Rhizobium pseudoryzae
7 3777652 3777795 - NZ_CP071454.1 Rhizobium lentis
8 1940888 1941031 - NZ_CP013500.1 Rhizobium esperanzae
9 1918305 1918448 - NZ_CP071612.1 Rhizobium bangladeshense
10 1942751 1942894 - NZ_CP013532.1 Rhizobium phaseoli
11 1968342 1968485 - NZ_CP071604.1 Rhizobium binae
12 1532180 1532323 - NZ_FO082820.1 Pseudorhizobium banfieldiae
13 1532556 1532702 - NZ_FO082820.1 Pseudorhizobium banfieldiae
14 1630417 1630560 - NZ_LR723670.1 Pseudorhizobium flavum
15 1630792 1630938 - NZ_LR723670.1 Pseudorhizobium flavum
16 1828717 1828860 + NZ_CP059896.1 Ciceribacter thiooxidans
17 1828299 1828445 + NZ_CP059896.1 Ciceribacter thiooxidans
18 2311752 2311895 - NZ_CP049250.1 Rhizobium rhizoryzae
19 2312167 2312313 - NZ_CP049250.1 Rhizobium rhizoryzae
20 2467693 2467836 + NZ_CP054027.1 Rhizobium hidalgonense
21 2467245 2467391 + NZ_CP054027.1 Rhizobium hidalgonense
22 1665994 1666137 - NC_020528.1 Sinorhizobium meliloti 2011
23 1712190 1712333 - NZ_CP006877.1 Rhizobium gallicum bv. gallicum R602sp
24 1538077 1538220 - NZ_CP034998.1 Rhizobium acidisoli
25 1538519 1538665 - NZ_CP034998.1 Rhizobium acidisoli
26 1348261 1348404 - NZ_CP023067.1 Ensifer sojae CCBAU 05684
27 1723199 1723342 - NZ_CP041238.1 Ensifer mexicanus
28 1923513 1923656 - NZ_CP032694.1 Rhizobium jaguaris
29 1369281 1369424 - NZ_CP015880.1 Ensifer adhaerens
30 1630588 1630731 - NC_020059.1 Rhizobium tropici CIAT 899
31 1631037 1631183 - NC_020059.1 Rhizobium tropici CIAT 899
32 1475161 1475304 - NZ_CP029451.1 Sinorhizobium fredii CCBAU 25509
33 1680326 1680469 - NZ_CP013107.1 Sinorhizobium americanum
34 1289515 1289658 - NZ_CP034909.1 Ensifer alkalisoli
35 1449251 1449394 - NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
36 1449644 1449790 - NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
37 2416731 2416877 - NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
38 1889876 1890019 - NZ_CP020906.1 Rhizobium etli
39 2211087 2211230 - NZ_CP071678.1 Rhizobium ruizarguesonis
40 590529 590672 + NZ_CP054021.1 Rhizobium indicum
41 1688764 1688904 + NZ_CP019044.1 Salaquimonas pukyongi
42 1504462 1504605 - NZ_CP020330.1 Martelella mediterranea DSM 17316
43 4469977 4470117 + NZ_CP015318.1 Mesorhizobium amorphae CCNWGS0123
44 107094 107240 + NZ_LR723671.1 Pseudorhizobium flavum
45 890439 890579 + NC_002678.2 Mesorhizobium japonicum MAFF 303099
46 3668164 3668304 - NZ_CP033361.1 Mesorhizobium erdmanii
47 4112624 4112764 - NC_015675.1 Mesorhizobium opportunistum WSM2075
48 1467130 1467276 + NZ_CP032695.1 Rhizobium jaguaris
49 448891 449037 - NZ_CP013503.1 Rhizobium esperanzae
50 2831024 2831164 + NZ_CP032509.1 Georhizobium profundi
51 1444027 1444179 - NC_014932.1 Bartonella clarridgeiae 73
52 85996 86148 + NC_008783.1 Bartonella bacilliformis KC583
53 31073 31219 + NZ_CP035001.1 Rhizobium acidisoli
54 144018 144164 + NZ_CP071456.1 Rhizobium lentis
55 2249988 2250140 + NC_012846.1 Bartonella grahamii as4aup
56 1549635 1549781 - NZ_CP017940.1 Phyllobacterium zundukense
57 1884255 1884401 + NZ_CP048635.1 Rhizobium oryzihabitans
58 2083959 2084105 + NZ_CP061004.1 Agrobacterium tumefaciens
59 5147487 5147627 + NZ_CP018171.1 Mesorhizobium oceanicum
60 1223815 1223955 - NZ_CP018171.1 Mesorhizobium oceanicum
61 1784057 1784209 + NZ_LR134527.1 Bartonella elizabethae
62 3427865 3428008 - NZ_CP041690.1 Youhaiella tibetensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP071454.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01134.24 0.74 32 138.5 same-strand Glucose inhibited division protein A
2 PF06568.13 0.81 35 299.0 same-strand Domain of unknown function (DUF1127)
3 PF05698.16 0.72 31 2678 opposite-strand Bacterial trigger factor protein (TF) C-terminus
4 PF05697.15 0.72 31 2678 opposite-strand Bacterial trigger factor protein (TF)
5 PF00254.30 0.72 31 2678 opposite-strand FKBP-type peptidyl-prolyl cis-trans isomerase
6 PF00494.21 0.65 28 2201 opposite-strand Squalene/phytoene synthase
++ More..