Result : XrpA
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | XrpA |
| NCBI Accession ID | AE014133.2 |
| Organism | S.mutans |
| Left | 1872134 |
| Right | 1872343 |
| Strand | - |
| Nucleotide Sequence | ATGATACAAAATTGTATATCTATTTTAAGACACGTTTTTCTAATTACATTAAAGATGTTTTGCGTCAGCAAGAAAGTCAGAAACGTCGTTTTAATAGAATGTCTTATGAAGAAGTCGGTGAGATTGAACACTGTTTGTCAAGTGGCGGTATGCAATTGGATGAATATATTTTATTTCGTGATAGTTTGCTTGCATATAAACAAGGTCTGA |
| Sequence | MIQNCISILRHVFLITLKMFCVSKKVRNVVLIECLMKKSVRLNTVCQVAVCNWMNIFYFVIVCLHINKV |
| Source of smORF | Literature-mining |
| Function | Produced from the same transcript as ComX but after degradation of 5' end. Interacts with ComR and inhibits competence. |
| Pubmed ID | 25620525 29802740 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1771180 | 1771389 | + | NZ_CP013237.1 | Streptococcus mutans |
| 2 | 195054 | 195263 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 3 | 830940 | 831128 | + | NZ_CP043405.1 | Streptococcus ratti |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013237.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00288.28 | 1.0 | 3 | 260 | same-strand | GHMP kinases N terminal domain |
| 2 | PF08544.15 | 0.67 | 2 | 294.0 | same-strand | GHMP kinases C terminal |
| 3 | PF01047.24 | 1.0 | 3 | 1732 | same-strand | MarR family |
| 4 | PF12802.9 | 1.0 | 3 | 1732 | same-strand | MarR family |
| 5 | PF13412.8 | 0.67 | 2 | 1743 | same-strand | Winged helix-turn-helix DNA-binding |
| 6 | PF13463.8 | 1.0 | 3 | 1732 | same-strand | Winged helix DNA-binding domain |
| 7 | PF00005.29 | 1.0 | 3 | 2192 | same-strand | ABC transporter |
| 8 | PF00950.19 | 1.0 | 3 | 2881 | same-strand | ABC 3 transport family |
| 9 | PF00579.27 | 0.67 | 2 | 3673.5 | opposite-strand | tRNA synthetases class I (W and Y) |
| 10 | PF01479.27 | 0.67 | 2 | 3673.5 | opposite-strand | S4 domain |
++ More..