Result : B0KA14
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000924.1 |
| Organism | Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum) |
| Left | 1358766 |
| Right | 1358978 |
| Strand | - |
| Nucleotide Sequence | ATGATTTTATATCCATCAATTGTAGATTTAATGGAAAAAGTAGATAGCAAATATACTTTGTGTTCTTTAGTTGCAAAAAGAGCAAGACAGCTTATTGCTGGTGACACTAAATTAGTAGACATAGATTCTGATAAACCTGTAACAATTGCTACAGAAGAAGTAAACAATGGACTTATTACTTATCAAAGACCGAAAAAATATGGAATAAAATAG |
| Sequence | MILYPSIVDLMEKVDSKYTLCSLVAKRARQLIAGDTKLVDIDSDKPVTIATEEVNNGLITYQRPKKYGIK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B0KA14 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 84
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1350957 | 1351169 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 2 | 1341045 | 1341257 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 3 | 1361091 | 1361303 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 4 | 1462649 | 1462861 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 5 | 1476509 | 1476721 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 6 | 1448655 | 1448864 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 7 | 1525910 | 1526119 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 8 | 1526271 | 1526480 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 9 | 1404749 | 1404955 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 10 | 1789794 | 1790003 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 11 | 3589361 | 3589567 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 12 | 1353305 | 1353511 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 13 | 79106 | 79315 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 14 | 2597592 | 2597798 | - | NZ_CP028842.1 | Clostridium botulinum |
| 15 | 2856182 | 2856388 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 16 | 1149097 | 1149303 | + | NZ_CP020953.1 | Clostridium drakei |
| 17 | 4044498 | 4044704 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 18 | 1157294 | 1157500 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 19 | 110232 | 110438 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 20 | 3118913 | 3119119 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 21 | 2146289 | 2146468 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 22 | 223319 | 223525 | - | NZ_CP023671.1 | Clostridium septicum |
| 23 | 1765032 | 1765265 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 24 | 1100474 | 1100680 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 25 | 344254 | 344430 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 26 | 1842906 | 1843112 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 27 | 1280485 | 1280694 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 28 | 1834236 | 1834442 | + | NZ_CP014176.1 | Clostridium argentinense |
| 29 | 1723871 | 1724077 | - | NZ_CP014204.2 | Clostridium baratii |
| 30 | 1810112 | 1810318 | + | NZ_CP040924.1 | Clostridium thermarum |
| 31 | 2941208 | 2941414 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 32 | 1018945 | 1019151 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 33 | 3206915 | 3207121 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 34 | 2259754 | 2259960 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 35 | 1241470 | 1241676 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 36 | 1164881 | 1165069 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 37 | 1016947 | 1017144 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 38 | 2174024 | 2174230 | - | NZ_CP009687.1 | Clostridium aceticum |
| 39 | 1328796 | 1328978 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 40 | 2421907 | 2422128 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 41 | 1005599 | 1005805 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 42 | 2465936 | 2466106 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 43 | 1790295 | 1790474 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 44 | 1389578 | 1389784 | + | NZ_CP048649.1 | Aminipila butyrica |
| 45 | 1112365 | 1112535 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 46 | 1826288 | 1826521 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 47 | 331751 | 331951 | + | NZ_LT996885.1 | Dialister massiliensis |
| 48 | 2131844 | 2132017 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 49 | 1394820 | 1395017 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 50 | 2404825 | 2405025 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 51 | 1605034 | 1605267 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 52 | 939823 | 940056 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 53 | 515540 | 515773 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 54 | 1733174 | 1733407 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 55 | 1087440 | 1087673 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 56 | 1130153 | 1130386 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 57 | 2235759 | 2235989 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 58 | 1180494 | 1180724 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 59 | 2806623 | 2806829 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 60 | 593477 | 593665 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 61 | 4869185 | 4869400 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 62 | 1570106 | 1570321 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 63 | 1124450 | 1124662 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 64 | 2005959 | 2006144 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 65 | 67343 | 67555 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 66 | 1648921 | 1649133 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 67 | 4021328 | 4021549 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 68 | 3053579 | 3053773 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 69 | 1286277 | 1286489 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 70 | 1450512 | 1450724 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 71 | 719827 | 720036 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 72 | 830870 | 831079 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 73 | 1881398 | 1881607 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 74 | 1060981 | 1061190 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 75 | 643823 | 644020 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 76 | 1366257 | 1366469 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 77 | 1542222 | 1542425 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 78 | 1527400 | 1527612 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 79 | 2075105 | 2075329 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 80 | 2911452 | 2911664 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 81 | 1014165 | 1014380 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 82 | 870969 | 871178 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 83 | 285372 | 285575 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 84 | 2867294 | 2867506 | + | NZ_CP009288.1 | Paenibacillus durus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014964.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00551.21 | 0.76 | 64 | 3977.0 | same-strand | Formyl transferase |
| 2 | PF02911.20 | 0.76 | 64 | 3977.0 | same-strand | Formyl transferase, C-terminal domain |
| 3 | PF01327.23 | 0.65 | 55 | 3520 | same-strand | Polypeptide deformylase |
| 4 | PF17764.3 | 0.79 | 66 | 1283.0 | same-strand | 3'DNA-binding domain (3'BD) |
| 5 | PF18074.3 | 0.77 | 65 | 1285 | same-strand | Primosomal protein N C-terminal domain |
| 6 | PF00270.31 | 0.79 | 66 | 1284.0 | same-strand | DEAD/DEAH box helicase |
| 7 | PF04851.17 | 0.77 | 65 | 1285 | same-strand | Type III restriction enzyme, res subunit |
| 8 | PF18319.3 | 0.79 | 66 | 1284.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 9 | PF04127.17 | 0.87 | 73 | 12 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 10 | PF02441.21 | 0.87 | 73 | 12 | same-strand | Flavoprotein |
| 11 | PF00625.23 | 0.99 | 83 | 5 | same-strand | Guanylate kinase |
| 12 | PF13238.8 | 0.85 | 71 | 5 | same-strand | AAA domain |
| 13 | PF04025.14 | 0.76 | 64 | 630.0 | same-strand | Domain of unknown function (DUF370) |
| 14 | PF03755.15 | 0.79 | 66 | 926.0 | same-strand | YicC-like family, N-terminal region |
| 15 | PF08340.13 | 0.79 | 66 | 926.0 | same-strand | Domain of unknown function (DUF1732) |
++ More..