Result : MspA
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | MspA |
| NCBI Accession ID | WP_202596579.1 |
| Organism | S.hominis |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MYLIVSYISIFKMKSMFVHILRIIMGILLLFVVAITTIQFPSENWWVFVVLLLLVGNVEVTAFKALKNDYKGVSILNIISIIIFVIYIILTFTMY |
| Source of smORF | Literature-mining |
| Function | inactivation of this protein results in loss of bacterium to secrete cytolytic toxins, protect itself from several aspects of the human innate immune system, and control its iron homeostasis. |
| Pubmed ID | 32571989 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1498478 | 1498720 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 2 | 219701 | 219952 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 3 | 1794784 | 1795035 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 4 | 772227 | 772478 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 698691 | 698942 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 2282564 | 2282815 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 7 | 2181667 | 2181918 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 8 | 2326712 | 2326963 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 9 | 758757 | 759008 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 10 | 1990230 | 1990517 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 11 | 2211920 | 2212171 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 12 | 1990553 | 1990804 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 13 | 2677040 | 2677291 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 601975 | 602226 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 15 | 1067968 | 1068219 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 16 | 885498 | 885749 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 17 | 696988 | 697239 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 18 | 1737702 | 1737989 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 19 | 712114 | 712365 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 20 | 660857 | 661144 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 21 | 778571 | 778846 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 22 | 1778353 | 1778604 | + | NZ_CP045927.1 | Staphylococcus agnetis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13468.8 | 0.86 | 19 | 5246 | opposite-strand | Glyoxalase-like domain |
| 2 | PF02388.18 | 1.0 | 22 | 3619.0 | opposite-strand | FemAB family |
| 3 | PF02355.18 | 1.0 | 22 | 222.0 | opposite-strand | Protein export membrane protein |
| 4 | PF06800.14 | 0.64 | 14 | 2309.5 | same-strand | Sugar transport protein |
| 5 | PF00583.27 | 0.77 | 17 | 3242 | same-strand | Acetyltransferase (GNAT) family |
++ More..