Protein Information |
Information Type | Description |
---|---|
Protein name | MspA |
NCBI Accession ID | WP_202596579.1 |
Organism | S.hominis |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MYLIVSYISIFKMKSMFVHILRIIMGILLLFVVAITTIQFPSENWWVFVVLLLLVGNVEVTAFKALKNDYKGVSILNIISIIIFVIYIILTFTMY |
Source of smORF | Literature-mining |
Function | inactivation of this protein results in loss of bacterium to secrete cytolytic toxins, protect itself from several aspects of the human innate immune system, and control its iron homeostasis. |
Pubmed ID | 32571989 |
Domain | |
Functional Category | Others |
Uniprot ID | |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1498478 | 1498720 | - | NZ_CP033732.1 | Staphylococcus hominis |
2 | 219701 | 219952 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
3 | 1794784 | 1795035 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
4 | 772227 | 772478 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 698691 | 698942 | - | NZ_LR134242.1 | Staphylococcus warneri |
6 | 2282564 | 2282815 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
7 | 2181667 | 2181918 | + | NZ_LT906460.1 | Staphylococcus simiae |
8 | 2326712 | 2326963 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
9 | 758757 | 759008 | - | NZ_CP064056.1 | Staphylococcus lloydii |
10 | 1990230 | 1990517 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
11 | 2211920 | 2212171 | + | NZ_CP033460.1 | Staphylococcus debuckii |
12 | 1990553 | 1990804 | + | NZ_CP013114.1 | Staphylococcus equorum |
13 | 2677040 | 2677291 | - | NZ_CP018199.1 | Staphylococcus succinus |
14 | 601975 | 602226 | - | NZ_CP065712.1 | Staphylococcus auricularis |
15 | 1067968 | 1068219 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
16 | 885498 | 885749 | - | NZ_CP018776.1 | Staphylococcus condimenti |
17 | 696988 | 697239 | - | NZ_CP008747.1 | Staphylococcus hyicus |
18 | 1737702 | 1737989 | + | NZ_LT906464.1 | Staphylococcus muscae |
19 | 712114 | 712365 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
20 | 660857 | 661144 | + | NZ_CP020773.1 | Staphylococcus lutrae |
21 | 778571 | 778846 | - | NZ_CP008724.1 | Staphylococcus xylosus |
22 | 1778353 | 1778604 | + | NZ_CP045927.1 | Staphylococcus agnetis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13468.8 | 0.86 | 19 | 5246 | opposite-strand | Glyoxalase-like domain |
2 | PF02388.18 | 1.0 | 22 | 3619.0 | opposite-strand | FemAB family |
3 | PF02355.18 | 1.0 | 22 | 222.0 | opposite-strand | Protein export membrane protein |
4 | PF06800.14 | 0.64 | 14 | 2309.5 | same-strand | Sugar transport protein |
5 | PF00583.27 | 0.77 | 17 | 3242 | same-strand | Acetyltransferase (GNAT) family |