Result : PepG1_long
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PepG1_long |
| NCBI Accession ID | KJ625227.1 |
| Organism | S.aureus |
| Left | 181 |
| Right | 315 |
| Strand | + |
| Nucleotide Sequence | ATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTAAGCAATAAAAAATAA |
| Sequence | MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK |
| Source of smORF | Literature-mining |
| Function | unconventional type I toxin system encoded by dual coding RNA. Accumulates at membrane killing the bacterium. When secreted toxin is hemolytic and toxic to other bacterial rivals. |
| Pubmed ID | 24703849 |
| Domain | |
| Functional Category | Toxin type 1 |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2037590 | 2037724 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 793360 | 793494 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 3257381 | 3257524 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 4 | 216864 | 217010 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
++ More..