Result : StreptolysinS
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | StreptolysinS |
| NCBI Accession ID | WP_002985285.1 |
| Organism | S.pyogenes |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGGSGSYTPGK |
| Source of smORF | Literature-mining |
| Function | It belongs to the microcin class of bacteriocins. Its main function is cytolysis. |
| Pubmed ID | 26204951 |
| Domain | |
| Functional Category | Bacteriocin |
| Uniprot ID | |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 550152 | 550313 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 2 | 233369 | 233533 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 3 | 749700 | 749861 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 4 | 1915254 | 1915415 | - | NZ_LR134293.1 | Streptococcus canis |
| 5 | 1003008 | 1003172 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP010450.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06160.14 | 0.6 | 3 | 3269 | same-strand | Septation ring formation regulator, EzrA |
| 2 | PF07997.13 | 0.6 | 3 | 2209 | opposite-strand | Protein of unknown function (DUF1694) |
| 3 | PF00113.24 | 0.6 | 3 | 675 | same-strand | Enolase, C-terminal TIM barrel domain |
| 4 | PF03952.18 | 0.6 | 3 | 675 | same-strand | Enolase, N-terminal domain |
| 5 | PF00881.26 | 1.0 | 5 | 222 | same-strand | Nitroreductase family |
| 6 | PF02624.18 | 1.0 | 5 | 2247 | same-strand | YcaO cyclodehydratase, ATP-ad Mg2+-binding |
| 7 | PF02517.18 | 1.0 | 5 | 3580 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 8 | PF19393.1 | 1.0 | 5 | 4249 | same-strand | Family of unknown function (DUF5968) |
++ More..