| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ListeriolysinS |
| NCBI Accession ID | WP_005729241.1 |
| Organism | Lactobacillus crispatus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MVIVEQKFNKYNHTSNMDAMEYAAGCCTCTTTSCTTSCAAVAES |
| Source of smORF | Literature-mining |
| Function | It is a bacteriocin killing bacterial species in vivo. It does not contribute to the pathogenicity and virulence in the host as it has weak hemolytic activity. It is expressed to target the host gut microbiota. |
| Pubmed ID | 28377528 |
| Domain | CDD:380218 |
| Functional Category | Bacteriocin |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |