Result : AgrD
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | AgrD |
| NCBI Accession ID | WP_011275303.1 |
| Organism | Staphylococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MTVLVDLIIKLFTFLLQSIGTIASFTPCTTYFDEPEVPEELTNAK |
| Source of smORF | Literature-mining |
| Function | Encodes the propeptide for the autoinducer peptide formation in the agr system in Staphylococcus. This protein leads to expression of virulence genes. |
| Pubmed ID | 15001569 |
| Domain | CDD:391800 |
| Functional Category | Quorum sensing |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1604974 | 1605111 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 2 | 1672238 | 1672378 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 3 | 1257131 | 1257271 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 929783 | 929923 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 38691 | 38831 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 6 | 886900 | 887040 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 7 | 1805059 | 1805196 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 8 | 2451232 | 2451369 | + | NZ_CP027770.1 | Staphylococcus felis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02517.18 | 1.0 | 8 | 4712.0 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 2 | PF00881.26 | 0.62 | 5 | 2277 | same-strand | Nitroreductase family |
| 3 | PF00795.24 | 0.88 | 7 | 1331 | same-strand | Carbon-nitrogen hydrolase |
| 4 | PF04647.17 | 1.0 | 8 | 3.0 | same-strand | Accessory gene regulator B |
| 5 | PF14501.8 | 1.0 | 8 | 26.5 | same-strand | GHKL domain |
| 6 | PF00072.26 | 1.0 | 8 | 1332.5 | same-strand | Response regulator receiver domain |
| 7 | PF04397.17 | 1.0 | 8 | 1332.5 | same-strand | LytTr DNA-binding domain |
| 8 | PF00294.26 | 0.75 | 6 | 2105.5 | opposite-strand | pfkB family carbohydrate kinase |
| 9 | PF00251.22 | 1.0 | 8 | 3054.5 | opposite-strand | Glycosyl hydrolases family 32 N-terminal domain |
| 10 | PF08244.14 | 0.88 | 7 | 3056 | opposite-strand | Glycosyl hydrolases family 32 C terminal |
++ More..