Result : PepA1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PepA1 |
| NCBI Accession ID | WP_148563157.1 |
| Organism | Staphylococcus aureus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLIFVHIIAPVISGCAIAFFSYWLSRRNTK |
| Source of smORF | Literature-mining |
| Function | It belongs to a type 1 toxin - antitoxin system located in a pathogenicity island in Staphylococcus aureus. In vivo, PepA1 localises to the membrane and triggers cell death.It is induced under acidic and oxidative stresses by reducing the antitoxin RNA. |
| Pubmed ID | 23129767 |
| Domain | CDD:411230 |
| Functional Category | Toxin type 1 |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1832812 | 1832904 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1557 | 1649 | + | NZ_CP013912.1 | Staphylococcus haemolyticus |
| 3 | 47990 | 48085 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 4 | 49949 | 50041 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 5 | 1257222 | 1257317 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 6 | 20417 | 20527 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 7 | 15437 | 15529 | - | NZ_CP018777.1 | Staphylococcus condimenti |
| 8 | 8514 | 8606 | + | NZ_CP035289.1 | Staphylococcus epidermidis |
| 9 | 5662 | 5763 | + | NZ_CP035289.1 | Staphylococcus epidermidis |
| 10 | 2600700 | 2600789 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 11 | 2430875 | 2430967 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 12 | 2457843 | 2457938 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 13 | 2646387 | 2646476 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 424679 | 424783 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 62297 | 62386 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 16 | 1174126 | 1174206 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 17 | 84435 | 84536 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 18 | 72185 | 72277 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 19 | 331830 | 331925 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 20 | 2499759 | 2499851 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 21 | 300730 | 300825 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 22 | 350494 | 350589 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 23 | 310349 | 310444 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 24 | 299521 | 299616 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 25 | 73372 | 73470 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 26 | 73144 | 73221 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 27 | 56639 | 56734 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 28 | 187322 | 187420 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 29 | 2505476 | 2505571 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 30 | 644833 | 644922 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 31 | 2504754 | 2504846 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 32 | 77699 | 77794 | + | NZ_CP022047.2 | Mammaliicoccus sciuri |
| 33 | 11457 | 11552 | + | NZ_CP022047.2 | Mammaliicoccus sciuri |
| 34 | 11769 | 11864 | + | NZ_CP022047.2 | Mammaliicoccus sciuri |
| 35 | 2034333 | 2034428 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 36 | 1049602 | 1049706 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 37 | 362481 | 362576 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 38 | 79842 | 79934 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 39 | 1054553 | 1054651 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 40 | 609024 | 609113 | - | NZ_LR134483.1 | Listeria grayi |
| 41 | 2088445 | 2088540 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 42 | 1678445 | 1678549 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 43 | 7923 | 8018 | - | NZ_CP033731.1 | Staphylococcus hominis |
| 44 | 25581 | 25682 | - | NZ_CP033731.1 | Staphylococcus hominis |
| 45 | 726484 | 726576 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 46 | 1142013 | 1142090 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 47 | 416428 | 416523 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 48 | 1013315 | 1013410 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 49 | 988440 | 988535 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 50 | 1108552 | 1108629 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 51 | 1604181 | 1604273 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 52 | 1063681 | 1063758 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 53 | 372304 | 372405 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 54 | 30271 | 30363 | + | NZ_CP065730.1 | Macrococcus caseolyticus |
++ More..