Result : TimP
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | TimP |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica |
| Left | 2726631 |
| Right | 2726747 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGTACGATGCTTTTGTGTCGTGCTTCTTGTTTCTGGCACGTTGTGTCTTCACGCAGACAGAAGCTACCCAGGTAATTCTGTTCCCGTAACGCTCAACGTCCAGAGCAGGTAA |
| Sequence | MKVRCFCVVLLVSGTLCLHADRSYPGNSVPVTLNVQSR |
| Source of smORF | Literature-mining |
| Function | inner membrane bound toxin type I which is repressed by antitoxin RNA TimR. Overexpression of this protein causes cytoplasmic membrane leakage. |
| Pubmed ID | 33172998 |
| Domain | |
| Functional Category | Toxin type 1 |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2675079 | 2675195 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 634540 | 634668 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 1922921 | 1923037 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 4 | 4908158 | 4908274 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 3179896 | 3180021 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00912.24 | 1.0 | 5 | 6348 | opposite-strand | Transglycosylase |
| 2 | PF06832.14 | 1.0 | 5 | 6348 | opposite-strand | Penicillin-Binding Protein C-terminus Family |
| 3 | PF17970.3 | 1.0 | 5 | 1416 | opposite-strand | Bacterial Alpha-2-macroglobulin MG1 domain |
| 4 | PF17972.3 | 1.0 | 5 | 1416 | opposite-strand | Bacterial Alpha-2-macroglobulin MG5 domain |
| 5 | PF17962.3 | 1.0 | 5 | 1416 | opposite-strand | Bacterial macroglobulin domain 6 |
| 6 | PF17973.3 | 1.0 | 5 | 1416 | opposite-strand | Bacterial Alpha-2-macroglobulin MG10 domain |
| 7 | PF01835.21 | 1.0 | 5 | 1416 | opposite-strand | MG2 domain |
| 8 | PF11974.10 | 1.0 | 5 | 1416 | opposite-strand | Bacterial alpha-2-macroglobulin MG3 domain |
| 9 | PF07703.16 | 1.0 | 5 | 1416 | opposite-strand | Alpha-2-macroglobulin bait region domain |
| 10 | PF00207.24 | 1.0 | 5 | 1416 | opposite-strand | Alpha-2-macroglobulin family |
| 11 | PF00581.22 | 1.0 | 5 | 356 | same-strand | Rhodanese-like domain |
| 12 | PF14581.8 | 1.0 | 5 | 37 | opposite-strand | SseB protein C-terminal domain |
| 13 | PF07179.14 | 1.0 | 5 | 37 | opposite-strand | SseB protein N-terminal domain |
| 14 | PF00883.23 | 1.0 | 5 | 923 | opposite-strand | Cytosol aminopeptidase family, catalytic domain |
| 15 | PF12404.10 | 1.0 | 5 | 923 | opposite-strand | Peptidase |
| 16 | PF04384.15 | 1.0 | 5 | 2358 | opposite-strand | Iron-sulphur cluster assembly |
| 17 | PF00111.29 | 1.0 | 5 | 2570 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 18 | PF00012.22 | 0.8 | 4 | 2860.0 | opposite-strand | Hsp70 protein |
| 19 | PF00334.21 | 0.6 | 3 | 8796 | opposite-strand | Nucleoside diphosphate kinase |
| 20 | PF04055.23 | 0.6 | 3 | 9387 | opposite-strand | Radical SAM superfamily |
++ More..