Result : NsiR6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NsiR6 |
| NCBI Accession ID | NC_000911 |
| Organism | Synechocystis |
| Left | 729671 |
| Right | 729871 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGTTTTCCCCGCAGAAACCTGTCCCGTGTGTGGCGTCACCATTGAAAATGGCTCCAAGGTGGTTTTTTCCTCTGGGCCGGCGGGAACGAGGGCCCGGCTCTGGGCCAGGGTCTGCAATTTTGCCCGTAACACCAGTTGCATCAATCAAGATGAAGCGGCGATCGGTAATGTTTCCAGCCGGGATTATTACGACTAG |
| Sequence | MSVFPAETCPVCGVTIENGSKVVFSSGPAGTRARLWARVCNFARNTSCINQDEAAIGNVSSRDYYD |
| Source of smORF | Literature-mining |
| Function | highly induced upon nitrogen deprivation. Multiple species protein alignment confirms the presence of 2 pairs of cysteine residues. It has been renamed NblD and it interacts with CpcB to open the phycobilisome structure to disrupt the hexamers, freeing them up for tagging and degradation by NblA-Clp |
| Pubmed ID | 27894276 33509926 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1687514 | 1687690 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 2 | 91338 | 91544 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014501.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05685.14 | 1.0 | 2 | 3432.0 | both-strands | Putative restriction endonuclease |
| 2 | PF18458.3 | 1.0 | 2 | 122.5 | opposite-strand | Xeroderma pigmentosum group B helicase damage recognition domain |
| 3 | PF04851.17 | 1.0 | 2 | 122.5 | opposite-strand | Type III restriction enzyme, res subunit |
| 4 | PF00271.33 | 1.0 | 2 | 122.5 | opposite-strand | Helicase conserved C-terminal domain |
| 5 | PF00270.31 | 1.0 | 2 | 122.5 | opposite-strand | DEAD/DEAH box helicase |
| 6 | PF01288.22 | 1.0 | 2 | 1563.5 | same-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
| 7 | PF00293.30 | 1.0 | 2 | 2055.0 | same-strand | NUDIX domain |
| 8 | PF03441.16 | 1.0 | 2 | 3068.5 | same-strand | FAD binding domain of DNA photolyase |
| 9 | PF00875.20 | 1.0 | 2 | 3068.5 | same-strand | DNA photolyase |
++ More..