Result : B0C8Q6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000828.1 |
| Organism | Acaryochloris marina (strain MBIC 11017) |
| Left | 6477769 |
| Right | 6478050 |
| Strand | - |
| Nucleotide Sequence | ATGATGCCAAATATAATTTGCCTTAAAGCAGTGATTTCAGGAAAGGTCCAAGGGGTGGGTTATCGTTACAGTACAAGAGCTAAAGCTCAGTCCCTTGGACTAGTGGGATGGGTCCGAAATTTGCCAGATGGCCGCGTTGAAGCTATGGCGGAAGGAGAGCGCACCCAAGTGGATAAACTAATTGAGTGGTTTAAACAAGGACCTCCTGCGGCAGAGGTCAGTAAGGTTGATGTTGATGAAGAATCCTTAGGGGAATTTCGAGCATTTGAAATTCTTAGATGA |
| Sequence | MMPNIICLKAVISGKVQGVGYRYSTRAKAQSLGLVGWVRNLPDGRVEAMAEGERTQVDKLIEWFKQGPPAAEVSKVDVDEESLGEFRAFEILR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 18252824 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | B0C8Q6 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 155
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6477769 | 6478050 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 2 | 5776969 | 5777202 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 3 | 1224313 | 1224546 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 4 | 325427 | 325654 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 5 | 773802 | 774074 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 6 | 547272 | 547577 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 7 | 3781863 | 3782129 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 8 | 753437 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 9 | 52866 | 53105 | + | NZ_AP018732.1 | Conexivisphaera calida |
| 10 | 93966 | 94247 | + | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 11 | 4194108 | 4194335 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 12 | 3390389 | 3390679 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 13 | 2671869 | 2672153 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 14 | 822030 | 822311 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 15 | 1944897 | 1945178 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 16 | 523638 | 523877 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 17 | 1569991 | 1570227 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 18 | 4511499 | 4511777 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 19 | 1098348 | 1098578 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 20 | 1979078 | 1979326 | + | NZ_CP007536.1 | Nitrososphaera viennensis EN76 |
| 21 | 990845 | 991078 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 22 | 829231 | 829461 | + | NZ_CP011267.1 | Geoglobus ahangari |
| 23 | 4873460 | 4873735 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 24 | 1569939 | 1570211 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 25 | 5320254 | 5320484 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 26 | 2379247 | 2379507 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 27 | 1638128 | 1638403 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 28 | 301217 | 301474 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 29 | 893046 | 893285 | - | NZ_CP009961.1 | Infirmifilum uzonense |
| 30 | 6903142 | 6903423 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 31 | 5275916 | 5276194 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 32 | 6208340 | 6208624 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 33 | 1879936 | 1880169 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 34 | 1953996 | 1954262 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 35 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 36 | 35519 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 37 | 4197205 | 4197444 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 38 | 4359445 | 4359684 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 39 | 1792169 | 1792408 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 40 | 3578178 | 3578405 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 41 | 2961651 | 2961920 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 42 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 43 | 3145120 | 3145380 | - | NZ_CP013481.2 | Pandoraea apista |
| 44 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 45 | 291851 | 292078 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 46 | 7675965 | 7676249 | + | NZ_CP023691.1 | Streptomyces platensis |
| 47 | 1717367 | 1717639 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 48 | 591286 | 591516 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 49 | 5606668 | 5606907 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 50 | 1374900 | 1375136 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 51 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 52 | 608986 | 609222 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 53 | 6826374 | 6826619 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 54 | 276885 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 55 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 56 | 1440730 | 1441008 | + | NZ_CP017715.1 | Marinobacter salinus |
| 57 | 3151140 | 3151367 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 58 | 442074 | 442328 | + | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 59 | 1766941 | 1767186 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 60 | 1163497 | 1163772 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 61 | 2131433 | 2131672 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 62 | 1841176 | 1841412 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 63 | 4660643 | 4660891 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 64 | 3737545 | 3737772 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 65 | 1643552 | 1643779 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 66 | 1447074 | 1447325 | + | NZ_CP013011.1 | Pyrodictium delaneyi |
| 67 | 1018630 | 1018905 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 68 | 2210465 | 2210695 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 69 | 943846 | 944073 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 70 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 71 | 1355157 | 1355429 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 72 | 1431650 | 1431928 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 73 | 2798764 | 2799021 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 74 | 2122378 | 2122611 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 75 | 3239581 | 3239865 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 76 | 2765194 | 2765442 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 77 | 2815366 | 2815602 | + | NZ_AP017558.1 | Halopenitus persicus |
| 78 | 1637334 | 1637612 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 79 | 2982610 | 2982855 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 80 | 1616022 | 1616288 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 81 | 2408913 | 2409197 | - | NC_018719.1 | Candidatus Nitrososphaera gargensis Ga9.2 |
| 82 | 3254430 | 3254678 | + | NZ_CP047385.1 | Pandoraea fibrosis |
| 83 | 2918923 | 2919186 | - | NC_023018.2 | Pandoraea pnomenusa |
| 84 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 85 | 2378882 | 2379145 | + | NZ_LT906435.1 | Pandoraea sputorum |
| 86 | 2791243 | 2791506 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 87 | 2148316 | 2148543 | + | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 88 | 957434 | 957667 | + | NC_022521.1 | Aeropyrum camini SY1 = JCM 12091 |
| 89 | 1481530 | 1481787 | + | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 90 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 91 | 1124409 | 1124720 | + | NZ_LR134350.1 | Actinomyces howellii |
| 92 | 656931 | 657158 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 93 | 1938801 | 1939082 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 94 | 2639834 | 2640112 | - | NZ_CP038853.1 | Pantoea vagans |
| 95 | 1501642 | 1501872 | - | NZ_LT981265.1 | Candidatus Nitrosocaldus cavascurensis |
| 96 | 212495 | 212725 | + | NZ_CP024014.1 | Candidatus Nitrosocaldus islandicus |
| 97 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 98 | 1566795 | 1567025 | + | NZ_CP062310.1 | Infirmifilum lucidum |
| 99 | 453127 | 453408 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 100 | 1428508 | 1428741 | - | NZ_LR134363.1 | Actinomyces slackii |
| 101 | 1490551 | 1490796 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 102 | 2030323 | 2030571 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 103 | 3051881 | 3052144 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 104 | 7004361 | 7004606 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 105 | 1598875 | 1599138 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 106 | 1956989 | 1957225 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 107 | 2693730 | 2693969 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 108 | 2371338 | 2371571 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 109 | 9041194 | 9041424 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 110 | 158351 | 158584 | - | NZ_LR134477.1 | Actinomyces viscosus |
| 111 | 668960 | 669199 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 112 | 2436023 | 2436286 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 113 | 651230 | 651499 | + | NC_015315.1 | Thermoproteus uzoniensis 768-20 |
| 114 | 2545171 | 2545425 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 115 | 2692406 | 2692684 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 116 | 691007 | 691255 | + | NZ_CP016804.1 | Halodesulfurarchaeum formicicum |
| 117 | 673459 | 673731 | - | NZ_CP013979.1 | Agromyces aureus |
| 118 | 1660441 | 1660701 | + | NZ_CP033238.1 | Saccharolobus solfataricus |
| 119 | 2380764 | 2381024 | - | NZ_CP077717.1 | Saccharolobus shibatae B12 |
| 120 | 515305 | 515541 | - | NC_013922.1 | Natrialba magadii ATCC 43099 |
| 121 | 128894 | 129145 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 122 | 2441747 | 2442016 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 123 | 642080 | 642334 | + | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 124 | 1143092 | 1143328 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 125 | 598524 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 126 | 1850320 | 1850559 | + | NZ_CP046378.1 | Shewanella algae |
| 127 | 3573773 | 3574060 | - | NZ_CP054254.1 | Klebsiella variicola |
| 128 | 2996337 | 2996624 | - | NZ_LR134201.1 | Cedecea lapagei |
| 129 | 224323 | 224610 | + | NC_010525.1 | Pyrobaculum neutrophilum V24Sta |
| 130 | 1085275 | 1085508 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 131 | 298355 | 298606 | + | NZ_CP054624.1 | Cupriavidus gilardii |
| 132 | 1020633 | 1020908 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 133 | 1279029 | 1279313 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 134 | 2068781 | 2069065 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 135 | 3300290 | 3300529 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 136 | 4163437 | 4163691 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 137 | 3419984 | 3420265 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 138 | 1948224 | 1948511 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 139 | 1177737 | 1178015 | + | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 140 | 413589 | 413867 | - | NZ_CP071463.1 | Haloterrigena longa |
| 141 | 2727916 | 2728197 | + | NZ_CP071883.1 | Curtobacterium flaccumfaciens pv. flaccumfaciens |
| 142 | 106467 | 106745 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 143 | 2190697 | 2190951 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 144 | 2336725 | 2336958 | - | NZ_CP017146.1 | Marisediminicola antarctica |
| 145 | 1087210 | 1087458 | + | NZ_CP082286.1 | Halobaculum roseum |
| 146 | 263125 | 263364 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 147 | 723746 | 723994 | + | NC_003364.1 | Pyrobaculum aerophilum str. IM2 |
| 148 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 149 | 12837 | 13067 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 150 | 754834 | 755112 | + | NC_009073.1 | Pyrobaculum calidifontis JCM 11548 |
| 151 | 3317888 | 3318121 | + | NZ_CP060790.1 | Acidovorax monticola |
| 152 | 2354876 | 2355154 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 153 | 2552852 | 2553097 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 154 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
| 155 | 928017 | 928247 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 156 | 1173076 | 1173363 | - | NC_008701.1 | Pyrobaculum islandicum DSM 4184 |
++ More..