| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | TrpM |
| NCBI Accession ID | AL939111.1 |
| Organism | Streptomyces coelicolor A3(2) |
| Left | 87421 |
| Right | 87612 |
| Strand | - |
| Nucleotide Sequence | ATGACGCTCCCGCTCGTCCCGGCCCGGGACCCGTACGCGCGCCTGGCGCGCGGCTGCCGCCCCCGCGGCTGCCGCGCCCCCGCCCGCCGGGTCCACGGCCGCCGGGTGCGGTACGTCATCGGAGACGAGCCCGGGCAGGTCAACGGCATGCGATGGCTCAAGCGCCCCATCAGGGGCGCGGGGCTGTATTGA |
| Sequence | MTLPLVPARDPYARLARGCRPRGCRAPARRVHGRRVRYVIGDEPGQVNGMRWLKRPIRGAGLY |
| Source of smORF | Literature-mining |
| Function | TrpM protein is a modulator of Trp biosynthesis. Its loss of function mutation causes growth delay and morphophysiological changes while overexpression enhances growth and Actinorhodin production. It is hypothesised to exert effect on Trp biosynthesis by controlling precursor availability. It is known to interact with PepA and regulate GlyA activity, which is required for Trp biosynthesis. |
| Pubmed ID | 27669158 32140146 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 63 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1797599 | 1797790 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 2 | 2991360 | 2991584 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 3 | 2540264 | 2540443 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 4 | 6273399 | 6273590 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 5 | 7200674 | 7200856 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 6 | 8578489 | 8578671 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 7 | 2778464 | 2778646 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 8 | 2702317 | 2702490 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 9 | 2212448 | 2212624 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 10 | 2367683 | 2367856 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 11 | 5896000 | 5896212 | + | NZ_CP022310.1 | Streptomyces calvus |
| 12 | 1780005 | 1780181 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 13 | 1603896 | 1604123 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 14 | 6441019 | 6441216 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 15 | 2525244 | 2525441 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 16 | 2570167 | 2570364 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 17 | 6491191 | 6491388 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 18 | 1861512 | 1861727 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 19 | 5985343 | 5985537 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 20 | 2184736 | 2184930 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 21 | 7311401 | 7311586 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 22 | 1491996 | 1492193 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 23 | 2124604 | 2124819 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 24 | 2762464 | 2762640 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 25 | 1064239 | 1064418 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03328.16 | 0.92 | 23 | 4205 | opposite-strand | HpcH/HpaI aldolase/citrate lyase family |
| 2 | PF01790.20 | 0.96 | 24 | 3139.5 | same-strand | Prolipoprotein diacylglyceryl transferase |
| 3 | PF13462.8 | 1.0 | 25 | 2278 | same-strand | Thioredoxin |
| 4 | PF01323.22 | 0.72 | 18 | 2272.0 | same-strand | DSBA-like thioredoxin domain |
| 5 | PF00290.22 | 1.0 | 25 | 1375 | same-strand | Tryptophan synthase alpha chain |
| 6 | PF00291.27 | 1.0 | 25 | 92 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 7 | PF00218.23 | 1.0 | 25 | 23 | same-strand | Indole-3-glycerol phosphate synthase |
| 8 | PF10825.10 | 1.0 | 25 | 973 | same-strand | Protein of unknown function (DUF2752) |
| 9 | PF09534.12 | 0.96 | 24 | 1964.5 | same-strand | Tryptophan-associated transmembrane protein (Trp oprn chp) |
| 10 | PF00425.20 | 0.92 | 23 | 2666 | same-strand | chorismate binding enzyme |
| 11 | PF04715.15 | 0.92 | 23 | 2666 | same-strand | Anthranilate synthase component I, N terminal region |