Result : FbpB
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FbpB |
| NCBI Accession ID | WP_010886410.1 |
| Organism | Bacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRIDRKHQKNLQEQNNT |
| Source of smORF | Literature-mining |
| Function | This small basic protein might serve as an RNA chaperone modulating the activity of FsrA RNA. It is required to repress the expression of iron requiring proteins in iron limiting conditions. |
| Pubmed ID | 18697947 |
| Domain | CDD:387731 |
| Functional Category | Regulator |
| Uniprot ID | P96609 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 459640 | 459819 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 506322 | 506501 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 504918 | 505097 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 483736 | 483915 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 662655 | 662801 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1503007 | 1503153 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 506378 | 506524 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3452942 | 3453088 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 497115 | 497261 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 593622 | 593777 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00375.20 | 0.7 | 7 | 3508 | opposite-strand | Sodium:dicarboxylate symporter family |
| 2 | PF00005.29 | 1.0 | 10 | 2489.0 | opposite-strand | ABC transporter |
| 3 | PF12730.9 | 1.0 | 10 | 1729.0 | opposite-strand | ABC-2 family transporter protein |
| 4 | PF08028.13 | 1.0 | 10 | 26.5 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 5 | PF02770.21 | 1.0 | 10 | 26.5 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 6 | PF13076.8 | 1.0 | 10 | -18.5 | same-strand | Fur-regulated basic protein A |
| 7 | PF01545.23 | 0.9 | 9 | 380 | opposite-strand | Cation efflux family |
| 8 | PF16916.7 | 0.9 | 9 | 380 | opposite-strand | Dimerisation domain of Zinc Transporter |
| 9 | PF00085.22 | 1.0 | 10 | 1263.0 | same-strand | Thioredoxin |
| 10 | PF07478.15 | 1.0 | 10 | 1735.5 | opposite-strand | D-ala D-ala ligase C-terminus |
| 11 | PF01820.23 | 1.0 | 10 | 1735.5 | opposite-strand | D-ala D-ala ligase N-terminus |
| 12 | PF02222.24 | 1.0 | 10 | 1735.5 | opposite-strand | ATP-grasp domain |
| 13 | PF13535.8 | 1.0 | 10 | 1735.5 | opposite-strand | ATP-grasp domain |
| 14 | PF08245.14 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase middle domain |
| 15 | PF02875.23 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase family, glutamate ligase domain |
| 16 | PF01225.27 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase family, catalytic domain |
++ More..