Protein Information |
Information Type | Description |
---|---|
Protein name | MgtR |
NCBI Accession ID | WP_139782944.1 |
Organism | Salmonella enterica |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MNRSPDKIIALIFLLISLLVLFLALWQIVI |
Source of smORF | Literature-mining |
Function | MgtR is encoded in the mgtCB operon. It promotes degradation of the virulence factor MgtC by FtsH protease. Therefore, it particpates in a negative feedback loop. It has been reported to directly interact with MgtC . |
Pubmed ID | 18200043 |
Domain | |
Functional Category | Regulator |
Uniprot ID | |
ORF Length (Amino Acid) | 30 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3571925 | 3572017 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
2 | 3628097 | 3628189 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
3 | 3961440 | 3961532 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
4 | 727002 | 727094 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
5 | 3099744 | 3099836 | - | NZ_CP060111.1 | Klebsiella michiganensis |
6 | 3942 | 4034 | + | NC_015963.1 | Enterobacter soli |
7 | 2951330 | 2951422 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00122.22 | 1.0 | 7 | 19 | same-strand | E1-E2 ATPase |
2 | PF00702.28 | 1.0 | 7 | 19 | same-strand | haloacid dehalogenase-like hydrolase |
3 | PF00690.28 | 1.0 | 7 | 19 | same-strand | Cation transporter/ATPase, N-terminus |
4 | PF00689.23 | 1.0 | 7 | 19 | same-strand | Cation transporting ATPase, C-terminus |
5 | PF02308.18 | 1.0 | 7 | 2907 | same-strand | MgtC family |