Result : MgtR
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | MgtR |
| NCBI Accession ID | WP_139782944.1 |
| Organism | Salmonella enterica |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNRSPDKIIALIFLLISLLVLFLALWQIVI |
| Source of smORF | Literature-mining |
| Function | MgtR is encoded in the mgtCB operon. It promotes degradation of the virulence factor MgtC by FtsH protease. Therefore, it particpates in a negative feedback loop. It has been reported to directly interact with MgtC . |
| Pubmed ID | 18200043 |
| Domain | |
| Functional Category | Regulator |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3571925 | 3572017 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 2 | 3628097 | 3628189 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 3 | 3961440 | 3961532 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 4 | 727002 | 727094 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 3099744 | 3099836 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 6 | 3942 | 4034 | + | NC_015963.1 | Enterobacter soli |
| 7 | 2951330 | 2951422 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020388.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 1.0 | 7 | 19 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 1.0 | 7 | 19 | same-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00690.28 | 1.0 | 7 | 19 | same-strand | Cation transporter/ATPase, N-terminus |
| 4 | PF00689.23 | 1.0 | 7 | 19 | same-strand | Cation transporting ATPase, C-terminus |
| 5 | PF02308.18 | 1.0 | 7 | 2907 | same-strand | MgtC family |
++ More..